SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302873878|ref|YP_003842511.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302873878|ref|YP_003842511.1|
Domain Number 1 Region: 197-281
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 2.98e-22
Family Invasin/intimin cell-adhesion fragments 0.0034
Further Details:      
 
Domain Number 2 Region: 285-368
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 4.71e-22
Family Invasin/intimin cell-adhesion fragments 0.0031
Further Details:      
 
Domain Number 3 Region: 48-196
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000000135
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302873878|ref|YP_003842511.1|
Sequence length 448
Comment Ig domain-containing protein [Clostridium cellulovorans 743B]
Sequence
MKSKKINKLAIALIMFLGMFLGTYTNAMAEGTTGTTTYSENLIPKMNGYTTDGVTVSSSS
DWSVDYIAWKAFNRNLDIPYEGINGNCWATVSGSVAGWLKVDFGVGNEKKVNKYTIKSRT
APDNNSSPKSWTFEGSNDNENWTVIDSRIDQLDWDDSIGEKREFTFSNNTKYRYYRINIT
ANDGQVHSSIDELEMMEAISVSNVTLNKTVDTLNIGDKEQLFASVEPYNAANKNLLWKSD
NPAVATVDSTGNVTAVAVGTAKITATTEDGSNLTTSCTVTVKQPIILISGIALNNKTLDL
ISGQSATLLATVTPDNATNKKVIWTSSNPSVATVDSTGKITAVASGTATITATTIDGTNL
SDSCAVNVKADTSNDVLLTIYLTNGNKKSYAITDEKLDDFLNWYNDRAAGIGKVYYGFEM
PPVSSEFKRRVEYVMFSMISDFVVDEYK
Download sequence
Identical sequences D9STD1
WP_010076406.1.47838 gi|302873878|ref|YP_003842511.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]