SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302873879|ref|YP_003842512.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302873879|ref|YP_003842512.1|
Domain Number 1 Region: 683-875
Classification Level Classification E-value
Superfamily Kelch motif 8.11e-33
Family Kelch motif 0.0015
Further Details:      
 
Domain Number 2 Region: 153-423
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.16e-20
Family Papain-like 0.011
Further Details:      
 
Domain Number 3 Region: 1288-1357
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000000167
Family Type I dockerin domain 0.0014
Further Details:      
 
Domain Number 4 Region: 1054-1110
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000883
Family Type I dockerin domain 0.0036
Further Details:      
 
Domain Number 5 Region: 1125-1204
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000163
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 6 Region: 598-697
Classification Level Classification E-value
Superfamily Kelch motif 0.00000144
Family Kelch motif 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302873879|ref|YP_003842512.1|
Sequence length 1359
Comment Kelch repeat type 1-containing protein [Clostridium cellulovorans 743B]
Sequence
MKNVKKLTKVLGIYTIVFSIVFSNFQGVLATTNVDKQETEETQMAVENDGHVNGAKPLTE
EEKQWMEENMIRSKVILPNKLGLERSNEVREKKGLSKIDESKAVKVGDEVIADTTSGGIT
AKATANATATSGSTTESAAVESITGESSTSTTIEASYLPNSVDNSELPFFPEIRSQGEIG
SCASFATTYYQATYMTAMARGWDVKNDTDDSKKFSPKWTYNLINGGVNSGSSEVSAYRLF
LEQGIATWKDFPYNGNNITQKDYLEWATNENVWKNALNFKADKAGYERISDGTDTPIQNE
TDDSLTKVKQLISNGYIFEITTDILDWKYKPISNNDLTSEDDKYVGRACAYIEDYSGTNG
HGMIVVGYNDNIWVDINSNGQMDVGEKGAFKIANSWGSTWGVDPNTNTNVYNSDGFIWVS
YDAINKVSSVLGAPEAQHQRDSIFNTFYWITAKTTNSPSLIACINVMHKERNQLRYEIGY
SDVTAPDSEITWAPITVNKDTGAYSFDGSSGTETQGTIVLDYSDLIKQGNLSDVTKRWYV
RITDINNDDIAGTNINFKVVDFTKEGKEFSCTTTNSQVNGGSITLYVDHALGTTSAVTNK
WNLKNGNPYTSNDNYNKDLITYDNKIYMYDMSNHNLVQYDSINNQWSIYDSTTWPELNVR
CRMVGYNGKIYVFKTDEALLSKPIYKMYVYDIATKTWDYTKAFLEEEISGSSIVECNGKI
YLIGGYRDTNSPDYNRVIHEYNPQTDSWVTKAELNVSRTYADSVAANGKIYIFKGQYGVN
EIKTIEVFDPILNKSSVLGDIPENISFYGGQPIINLEGKIYFFGDSKYLVQEIYEYKPTS
NSWTKVSEVPGIATTNKAIVCNNKIYTMVGSENNFYEFNSSVQVPVELERIGIPYFNILN
GTYSTQQTVSINCFTIGAKIRYTTDGSTPTETSTEYTGPITVADDMTIKAIAMKAGMTDS
YVITGDYKIQPPVANPVLSLAEGNYKQGKILTISSATEGANISYRLTFGQTPGEWFQYTG
PINIIGNITVTAKATKVDMTNSDTINQNYRIRSIIGDVNGDGKISISDYIIQKRIEDPNY
DLPIDDDLWGGDVTGDGLINNDDYVLIKQCRTEGENFGYFPKEIMPLNVSLKDTPENSVT
IGWDNSLGVANIVSYQVYRDGSLVGTTSSTSYTDSEVTGDSDYIYTVRSVLEDGTISNAS
IPLTVKAFIKTPTFSVGTGTYTSVQTLNISCGTPGATIVYTIDGTEPTSTSEVYTSPISI
GGTKTIKAKAIKTGIPDSNTVSSTYTMNFKIGDVNGDGTINTDDTNMLKSYILSNITSFP
VEDKMWVADVDGNNRIDGMDAIYINQYIAGTRTKFPKEA
Download sequence
Identical sequences A0A173N061 D9STD2
gi|302873879|ref|YP_003842512.1| WP_010076405.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]