SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302873894|ref|YP_003842527.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302873894|ref|YP_003842527.1|
Domain Number 1 Region: 46-272,307-383
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.57e-38
Family Pectin lyase 0.071
Further Details:      
 
Domain Number 2 Region: 514-574
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000000216
Family Type I dockerin domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302873894|ref|YP_003842527.1|
Sequence length 575
Comment Dockerin type 1 [Clostridium cellulovorans 743B]
Sequence
MLRKKTKKNAFNSKSKRNLVSTSCVLSLILGNVCAYNSSTVYAGTEPTIAFQGADGGGKY
ATGGRGGEVVYVTNLNDSGVGSFRDAVGTSNRIVVFAVGGTIELKSDVVVKSNVTIAGQT
APGGAGITLKNFKIGMGGSNIIMRFISSRPGERGTNADYDAFGGSDGSNSIVDHCSMGWA
NDEQWGLYSANDNATIQYSIVGPSNSFSYHSKGIHGFGIMLGRSNVSWHHNLIVHNVSRN
FRGKVVGTSSAEFTNNIIYNWASQTAYGTLGHLNYVNNTLKKGVSTVGGHNYVSVADSGT
APENYSIYLTGNRFLNSDNSNYSTFTQNNWSGISYGTGKDESNTKSNTPFKLLVNGFDAS
TVPKVESSEASYDHVLEFAGAGITSTQRPAIDQQVATETKTGTGTLTGARPYAEATAEQK
ATIDKYKMQCGVVYQYPKAVLTGAKVDTDKDGMADEWEVARGLNPNSKTTADGKPEANGD
YCGQGYANIEYYINDLTINAFPKGVVTLSPTTKVTVLGDVNKDGKLSALDLAWLKKYILG
GTTLTAEQLKSADMNNDGKANALDLALMTKKILSQ
Download sequence
Identical sequences A0A173MZS7 D9STE7
gi|302873894|ref|YP_003842527.1| WP_010076390.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]