SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302873905|ref|YP_003842538.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302873905|ref|YP_003842538.1|
Domain Number 1 Region: 771-840
Classification Level Classification E-value
Superfamily Type I dockerin domain 5.3e-18
Family Type I dockerin domain 0.00088
Further Details:      
 
Domain Number 2 Region: 133-426,524-573
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.00000000000000157
Family Integrin alpha N-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302873905|ref|YP_003842538.1|
Sequence length 840
Comment Dockerin type 1 [Clostridium cellulovorans 743B]
Sequence
MLKKALLSVFMGAAVLLGSIAPQTITTTAATARQMENLDRGVVAVKVSNGVFVSWRVLGT
EATNVSYNLYRDSVKVANITGASNYIDASGTTTSKYSVSAVVNGVEQSKSTAVSVLGNNY
MQLPLQIPAGGKTPDGVAYTYNANDCSVGDLDGDGQYEIVLKWDPSNSKDNSQKGYTGNV
FLDAYEMNGTRLWRIDLGKNIRAGAHYTQFMVYDLNGDGKAEVACKTSDGTKDGVGTVIG
NASADYRNSSGYILSGPEYLTIFQGSNGKALNTINYEPGRGTVSSWGDSYGNRVDRFLGC
IAYLDGVHPSLVMCRGYYTRAVLVAYDWNGSTLTKRWTFDSNTSGNSGYAGQGNHNLSVA
DVDSDGKDEIIYGGCTIDDSGKGLYTTGLRHGDALHVSDLDPSRHGLEVWSCHEDTSGNG
GIGGSFRDAKTGQVLWSFKAANDTGRACSADVTAAYPGEEVWASGSSLYSSKGENIGNRP
GPVNFAIWWDGDELRELLDDTTISKYGGGNLLSVSDCDSNNTTKATPCLQADILGDWREE
VIWRTTDNKYLRIYTTTATTSRRIYTLMHDPVYRMGVAWQNVAYNQPPHTGFFLGSGMST
PPTPAIKLVGATTPTNPTAPTTILDGQYIKSLVVKDTNNASDWSIQSNLKVGDPVYGDRT
NKFTVIPSKLLGSEWIRTACDSKTYTSDLASFTTKSDVSVYVGIDARISSIPAWLSSWTN
TGETLTNDSDVTFNLYKKDFSTNSNVVLGTNSASSSAVNYTAIVVKNTPSSLIYGDVNGD
SAVNAIDYAFMKKYLLGTTTSMPSPNWQKVGDLNSDGVINAIDYAYLKKYLLGSITKLPV
Download sequence
Identical sequences D9STT6
gi|302873905|ref|YP_003842538.1| WP_013291638.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]