SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302873906|ref|YP_003842539.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302873906|ref|YP_003842539.1|
Domain Number 1 Region: 567-707
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.32e-25
Family Ricin B-like 0.0038
Further Details:      
 
Domain Number 2 Region: 55-247,301-367,432-540
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.71e-24
Family Pectate lyase-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302873906|ref|YP_003842539.1|
Sequence length 710
Comment Pectate lyase/Amb allergen [Clostridium cellulovorans 743B]
Sequence
MKFRKIFSVALAGALLLTSTSLFGEGNVADAAVISSIPNTTRTLKSYDNSFLSVTGYASL
SGGVKDRSSYVGTSYYRTVKTSREFLQALLDAKSGSVKVIEIAANLNLGWKELNLSSTEI
QKYNFVAKYEDPTNGYTNPTLQANGVSKINVSDTNGLTIFSTSGSTIKHAELKLQSSAND
IVIRNLNFDEMWQWDDVGNHKEVGWTFIKVNGANNVWIDHCKFAIGADGMVDIENGSSGL
TFSWCKFGLEANTNPASDSAIYKSITYMEQKYTSNQLASTSLYYKMRKAGATPNQIMAYS
AYHSKCHLVGSGDKDYVNYVDSNGKDYKDGNQRLRITLAYNQYSNVGQRVPMIRQGVGHM
INCYIDDTTHMNLENSVSSFKANSTSLARGMNARNGASIAADTCVYNGVTEPIVGTELQG
QDTSNMDPQWANLFKNAYNRNLIVNSQVTNANGTYTGSSWDNNGVNLFTKGFVWYNKSTL
NKWAWSSSIVGAANMSKTKPPTTPFTFQYNYTEKLPYSYNAVPLNDVVQTVKQYSGASKV
TLSAKDWLKTVYSTSSTPTTGSSVNVGSYYRIKNVNSGKYLSAPTDASGTKLVQTADKTQ
ATSLWRIVAGDTGYVNLVAQVGSASKVIDIPGASTDNGVQLQIWGGTAGADWQQFKLKDN
GDGTFGILTMISGGTQGLDVNAKSTAEGASVIQYNYAASANQKWVFEFVK
Download sequence
Identical sequences D9STT7
gi|302873906|ref|YP_003842539.1| WP_010076378.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]