SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302873908|ref|YP_003842541.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302873908|ref|YP_003842541.1|
Domain Number 1 Region: 29-200
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.94e-17
Family SPRY domain 0.0064
Further Details:      
 
Domain Number 2 Region: 205-280
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.00000000000000126
Family Invasin/intimin cell-adhesion fragments 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302873908|ref|YP_003842541.1|
Sequence length 292
Comment Ig domain-containing protein [Clostridium cellulovorans 743B]
Sequence
MEKKSYKRIRTSIITMLIFILASSNVFAATATTWNPVNKSVGATLSNGNLTVTGGLGGSV
KATNYKTTGKWYWEVTNVSSAFNLAGVANELFIARTENFESKNQKSYNGYNGNMYPLTSD
PLINKYGEALKAGDILGIALDIDNKTINFSKNGNWFGDRPLPTWNQYYPMVTFGSSSYGG
TTTTNFGATPFKYQPPTGFYPYDGVPSTGLYLNKSITDLNIGQEETLIATVTPPEASNKY
IEWVSQDPTIATVDATGKVTAIKEGQTRIVASHVDSNSIFTAGCIVNVTPAS
Download sequence
Identical sequences D9STT9
WP_010076376.1.47838 gi|302873908|ref|YP_003842541.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]