SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302874022|ref|YP_003842655.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302874022|ref|YP_003842655.1|
Domain Number 1 Region: 401-770
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.21e-51
Family beta-glycanases 0.00000523
Further Details:      
 
Domain Number 2 Region: 889-1057
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.38e-20
Family CBM11 0.044
Further Details:      
 
Domain Number 3 Region: 62-198
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000000000476
Family Family 27 carbohydrate binding module, CBM27 0.0096
Further Details:      
 
Domain Number 4 Region: 211-367
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000000191
Family Family 27 carbohydrate binding module, CBM27 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302874022|ref|YP_003842655.1|
Sequence length 1292
Comment LPXTG-motif cell wall anchor domain-containing protein [Clostridium cellulovorans 743B]
Sequence
MGIGRFKKGLAALVALALTLSAAPATVLEVKAEGTTQTVIYSNDFEDASKLPEKKTAADL
VGGINGSTALGFDYTFDKSKDWDQKDIQMNYQYADPITAGAKLSVDVILPKDGTYNGTLK
LQAATQLGANWAWTKATEEQSIDLSKFVVVGDYKVQTIQFTFGDEIASIQGLNSIIVQVV
GNYCDYNGKVLIDNVKLIDGVAPSTNKKVYYTNDFESSTKLPENSSLVSGINGSTVLGFD
YTFDKGQSWDQRDIEFKYEYADPIVEGAKLSVDVILPKDATYDGTLALKAATQMGPSPWT
WTEAADVQTLALDKFTTVGDYKVQTLTFTFGSKITEKQGLHGIFLQTVGKNCNYAGKFYI
DNIKLIEGEIAAPTEKYVLKTVEPTAQTKVEPSKLNIPSTVSLIDSKSIANTANLYAYLK
AVGESDYLIFGHQNDLHSKAGSSKLSKSDTMDMTGSISGVVGIDSLSLTGAELQVPDGDP
RSAATYVADLSEKAAKQGAIITLSMHMPNFDLVKEKGKKKDGKWDFTGYTPNTTTGNVMQ
RILPGGDLNEVFTSYMDIIADYANQLEARGIPVLFRPFHENSGGWFWWGSATCDQAGFRN
VWRYTVDYMRDVKDTHNLIYVYSPNGTFENEASYLDRYPGDEYVDVMAMDLYNQNPTLTD
NFPTILADNMKMIDGIAAKHNKVTAVSEAGILCTGFNGMKVTGNKRVTWFEDVLNTVAST
NAAYLLTWANFGETSGIFMPYMADETHGHEMLNSFIKFYNDEKSVFADGVGDFSSLNVTN
TDAYTNTTGFMVAPTSGSRMLEASKLQATVKNTDKEVSFVLKNSDGVVIKTLKAAANGTT
YTAQVTDEILKAIAPTFGTIDLTVGGQVYDTVKVMFNIKEVPVNPAMGDDFEYYYGNDDL
LGTQWSTNFGPGCSITPMTTNKVGEHNNGEYGVAFKYKISTEKASEGWAGMTKNMGKDWS
PYDALQIWIKPDGYGQKLVVQITSKGEDFEVHLPEFAATKEAKLLTIPFSKFVGKNKGIF
DPKNIDRIGVWCNTIIPEGQAGITVDSTMYIDDIKAVKTNVASGAQDLLSKLEAVKDTEI
IFTPDSDIIPVNAFKLAKQNNNKILVVKDKVSFKFDDKAVLDTIINSNLVDLKLISKVLK
NDTVKKFIEGQGAKLLAGYSFENNLADGKFGGKVNMNIKVDPAYTGKKLFVYFVDKNSKY
KLVDSPVVAEGGDCTVYIEHFSDYVVTDKELDLSVVNPGVNPGSNPSNGNGITTTLPQTG
SPVDKNVLLGLGALILLAGAAVVGLARRKERE
Download sequence
Identical sequences A0A173N033 D9SU53
gi|302874022|ref|YP_003842655.1| WP_010076258.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]