SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302874039|ref|YP_003842672.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302874039|ref|YP_003842672.1|
Domain Number 1 Region: 150-361,415-455
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.68e-49
Family Type II chitinase 0.0077
Further Details:      
 
Domain Number 2 Region: 33-123
Classification Level Classification E-value
Superfamily Fibronectin type III 2.22e-16
Family Fibronectin type III 0.00086
Further Details:      
 
Weak hits

Sequence:  gi|302874039|ref|YP_003842672.1|
Domain Number - Region: 356-401
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.0421
Family Chitinase insertion domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302874039|ref|YP_003842672.1|
Sequence length 457
Comment glycoside hydrolase family protein [Clostridium cellulovorans 743B]
Sequence
MRSFRKLMMIFSLIAVFLLNASFVSAKPARKTGTPPTAPTSLTYSGVTTSEATLTWQGVS
GATGYSIYRATPNDSNYTLLTKVTTTSFKNTALTANTKYWYFVRAYNAYGTSPDSTHINL
TTAQIVVEPEPTPVPVEPTPTPVAKKLVLGYTTYYYSGDSSSYNSMTTNTSTLDEIATAT
YTTDAYGNVTGLVPTNQITYANSNNIKTLAMIANNFDGNIARSVLQNSVNRQAFINNILN
IVKVNGYKGVNIDLEGVYASDRSYLTTFMSELYNTLHPQGFYVSMAVPAKTFDSLTNSWT
GAYDYAALGKYVDQMVLMTYDEHYPGGTAGPVASIGWVESVIKYAVSVIPKEKILVGTAA
YGYDWSSNGTKAYGINGINNLATTYGATIQWDSVSQCPYFNYTDASGVSHSVWFENAYSL
NFKLDLVNSYDVAGIAIWRLGLENADYWTSIKTKFNR
Download sequence
Identical sequences D9SUK3
gi|302874039|ref|YP_003842672.1| WP_010076239.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]