SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302874061|ref|YP_003842694.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302874061|ref|YP_003842694.1|
Domain Number 1 Region: 33-407
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 4.25e-104
Family Cellulases catalytic domain 0.0000000338
Further Details:      
 
Domain Number 2 Region: 414-472
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000000981
Family Type I dockerin domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302874061|ref|YP_003842694.1|
Sequence length 472
Comment glycoside hydrolase family protein [Clostridium cellulovorans 743B]
Sequence
MKKIGATLAIASIAVSSISSISAYAADTATNGAYYTNTYRNLFVESGKTQAQVDEKINKM
FNQYFYGNDDQRIYYPVGTDMGYIKDIGNNDVRTEAMSYGMMIAVQLDKKDEFDRIWKWA
RTYMYHPDGQFKGYFAWQCDTNGKILDNTPAPDGEEYFVMSLLFAANRWGNGSGIFNYKA
EAQGIMDAMLHQADDGVGVNFFNSTNNQIVFCPIPDVATFTDPSYHLPAFYDLWALWADK
DNDRWATIAKTSREFFKKTVHPTTGLSPEYANFDGSPKEVSWISGRGNYSYDAWRTIANS
SVDYAWWGKDPWQQTFANNLQNFFYSQGLSSYVDKYTVSGTKVGVDHSVGVVAMNAVGSL
AATNSHATEFVNELWNTYAPTGTWRYFNGSLYLLGLLECSGNFKIWKPQQVKPIPLAGDV
NGDGKVNAIDLAVLKSHLLGNNVAINKDNANLNGDSAINAIDLALLKKKILG
Download sequence
Identical sequences D9SUM5
gi|302874061|ref|YP_003842694.1| WP_010076216.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]