SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302874067|ref|YP_003842700.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302874067|ref|YP_003842700.1|
Domain Number 1 Region: 683-798
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 3.14e-20
Family Cellulose-binding domain family III 0.011
Further Details:      
 
Weak hits

Sequence:  gi|302874067|ref|YP_003842700.1|
Domain Number - Region: 813-865
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00147
Family Type I dockerin domain 0.0069
Further Details:      
 
Domain Number - Region: 157-221
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 0.0824
Family STM3548-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302874067|ref|YP_003842700.1|
Sequence length 872
Comment hypothetical protein Clocel_1180 [Clostridium cellulovorans 743B]
Sequence
MKSKKRICTLLVAMFMFLVFVSPNVAYAEVGTTQATPTLTATPNNEGNYISLKWTAPDPS
KSYSYMIYSKKSTEAEFQSIPAKGTVKALNIYPNPVSNTGLSGGEKDLDGNSIPDSGILK
TWLAKENINTITIESVSLTSFNSNPSKYLAKSNGKWNYDSVFYGMWNLDPQNMYPNDTAI
EYLRTFINDGGGFMTSHHTIGYMGLDRGVNKLAKELGVEIFGRAQANIIQPYTCRDANGH
LFPTVSFEVDDPSSTANADCTSYWNSSTKVQLGKSGLLNNYPFKVGNIGDTFDIPYQHGL
SVFGKGDIWMTSVNPLGFVGIPFKEITISPSTGAKGTNNFYLHTYNNTAIINSGHSFPQI
TQAETRIIANTLYYLSQVTNQTSWDDHKGQDVDSPTKPNITRVAVDKAANKTNITFEPST
DKGTIYDYYIQAKELITSNKTNSEVKSTTITSGLKGYSIVVDKNPSTIPGNTITTTSPSY
SVNGAFTEDCYIHVAAVDNVGNVSEVSHYKYTNPVLSMTLTPSTTELQRDPVTIIAVATS
TNIAIAKIQTPDGNWVDGATANYDVNENGDYKFTAVDELGNQITQSITISNIIPKPVLSL
ALTPSITADTNGPVTISATATSTNTKIIKVQTPDGKWVDGSTVDYVVSSNGTYKFTAVDE
LGYEVTESVEVNNIFKVVLNVEPERNRIHLNETVTANLTIDNIKEIAAEDIRIKYDTTKL
QFLGYEQVDGIKLMKSSSQNGELRFILVSKGLLNVVNSKTILLKLKFKGIAPGDGLVDVT
KGRVSDGILMEKNLKDVECGQVNINVADEELIDVNADDEFSLLDLGILGRHLGEDPADLP
EYNADVVLNDAIDDEDLAEVVKFMLLNPNYNF
Download sequence
Identical sequences D9SUN1
WP_013291649.1.47838 gi|302874067|ref|YP_003842700.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]