SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302874069|ref|YP_003842702.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302874069|ref|YP_003842702.1|
Domain Number 1 Region: 1108-1223
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 7.07e-19
Family Cellulose-binding domain family III 0.012
Further Details:      
 
Weak hits

Sequence:  gi|302874069|ref|YP_003842702.1|
Domain Number - Region: 1238-1290
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000128
Family Type I dockerin domain 0.0052
Further Details:      
 
Domain Number - Region: 882-1081
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.00259
Family YVTN repeat 0.0062
Further Details:      
 
Domain Number - Region: 461-529
Classification Level Classification E-value
Superfamily PKD domain 0.0192
Family PKD domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302874069|ref|YP_003842702.1|
Sequence length 1297
Comment hypothetical protein Clocel_1182 [Clostridium cellulovorans 743B]
Sequence
MKNEKRIFTLILAMFMFLVFVSPNVAYAEAVTTQAAPTLTATPNNQGNYISLKWTTPDPT
KNYSYMIYSKKSTDTEFQSIPAKSNVKVLNVYPGVGNNLKTWMETNGYGKGYISVDEVDI
DTFNANPNSYLKDINGKWKYDVIYEGAWDSNNFKDLSVSATNAIEEFIKAGRGYLAGHDA
LYPYMPARNQLASYLNIIPTDYLMYGSTSVKINRKGLLTNYPWEIGDINTTLSVPLSHTG
QYASGDVWIKYSSNSMNSNAEITSYNGKATSNNFYLTTWNNTAMIQTGHSNGEATPDEQK
ILANTLFYLAQVTEATSWDDHKGQDLDAPSKPNVTSVAANRVTNKTNITFQPSIDKGTTY
DYYIEAKEATTSIKTNSQIKTATITSGLKGYSIVVDKNPSTVPTKTITTISTNYSIDGAV
TEGSYVHVASIDNVGNVSEVSHYKYVNPILSLTLTPSTAELQRNPVTITAAAISTNTTIT
KIQTPDGNWVNGSTAKYVVSKTGDYTFTAVDELGNKITQKITVTIKPQPALSLTLTPSTR
ELQRNPVTITATATSTNTKIVKIQTPDGNWVNGSTASYVVSKNEDYEFTAVDELGNEITQ
IIKVTNIIPKAVLSMILTPSTTVLQRNFVITITASATSTNTKIVKIQTPDGNWVNGSTTN
YIVSEDGDYKFTAVDELGDEVTQSIRVKVPPKPVLSMTLTPSTTELQRDPVTITASATST
NTKIVKIQTPDGNWVNGSTASYVVSKNEDYKFTAVDELGNEITQIIKVTNIIPKAVLSMI
LTPSTTVLQRNFVITITASATSTNTKIVKIQTPDGNWVNGSTTNYIVSASGYYKFTAVDD
LGDEVTQSISVEVPPKPILSMKLTPSTTELQREPVTITASATSTNTKIVKIQTPDGNWVN
GATVSYVVSENRDYIFTAVDELNNEITQSIKITNIIPKPVLSMTLTPSTTELQRNPVTIT
AVATSTNTKIVKIKTPDGNWVNGATVSYVVSENRDYIFTVVDELNNEITRSIKITNIIPK
PVLSMALTPSITADTNGPVTISATATSTNTKIVKVQTPDGNWVDGSTVDYVVSANGTYKF
TAVDELGNEITESVVVNNIFKVVLNVEPERNRIHLNETVTANLIIDNIKEIAAEDIRIKY
DTTKLQFLGYEQVDGIKLMKSSSQNGELRFILVSKGLLNVVNSKTILLKLKFKGIAPGDG
LVDVIKGRISDGILMEKNLKDVECGQVNINVADEELIDVNDDGEFSLLDLGILGRHLGED
PADLPEYNADVVPNDAIDDEDLAEVVKFMLLNPNYTF
Download sequence
Identical sequences D9SUN3
gi|302874069|ref|YP_003842702.1| WP_013291650.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]