SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302874070|ref|YP_003842703.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302874070|ref|YP_003842703.1|
Domain Number 1 Region: 95-261
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000129
Family Fibronectin type III 0.0037
Further Details:      
 
Domain Number 2 Region: 628-785
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000192
Family Fibronectin type III 0.0036
Further Details:      
 
Domain Number 3 Region: 272-432
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000996
Family Fibronectin type III 0.0053
Further Details:      
 
Domain Number 4 Region: 1083-1244
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000213
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 5 Region: 451-605
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000216
Family Fibronectin type III 0.0036
Further Details:      
 
Domain Number 6 Region: 808-972
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000597
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 7 Region: 986-1078
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000967
Family Fibronectin type III 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302874070|ref|YP_003842703.1|
Sequence length 1847
Comment fibronectin type III domain-containing protein [Clostridium cellulovorans 743B]
Sequence
MGNHETQSHGPVPHIICWMAAGYHEEYSYRWITIHFFATKNFPFLFPFSQRKAGSIMKKY
YLSSCLFLASLLLTLQLVFPFVTVSAATINTNLLPPSNLALELTTPSDVKLTWSSVYGAT
GYTIYGIIDGQLIQLATTTSTSYTFNNQAEGAYSYVVSTSSGDSESGPCAPVSATVDYPT
MAAPATLTGKIQNGNDIALSWTSSQYAQSYNVYQVSTNGDKTLVTSVKTTSYTIPNVVAG
SYTYSVSAVNALYGESVPSSEAKLDVIYPVMSVPGNFTYTIANGNDITLKWTGTPYATSY
KVYQVINGEKVLKSTVSTTSASYTNMPAGDYAFEVYSFSDRFGESQVGSATSLSLTLPVM
QAPSNLTYTVTNGNDITLKWSPSTYATAYNVYQIINGEKVLKSTTTSTTAVYSNLPESDY
SFEIYSYSSRFNESPTGSQTSLSLVWPVMQAPENLTYSIANGNDISLKWTAIPYAKGYKV
YQIVNGERVLKSTVTTTAVTYANLPAGDYTYEVTSYSDRFGETPAGSTTNISLILPVMEA
PTSAIQAIKSATSFTLTWDAVPYATSYKVYQVVNGQKVLKSTVTTTSVSYTNMTAGSYIY
EIHSYSTRFGESAEGFTLTFTLNGQVLQAPTNLTYTITNGNDITLKWTAAPYATSYKIYQ
VINGELVLKKTVTTTAAAFTNMPEGDYYFVVNSVSAVLGESPVGAETTFSLTHPVIAAPG
NLTYAIKNGNDITFTWSAVPYANSYKLYELVDGQYVLKTTVTATSATLSNVSEGDHNYYV
TAVSSRFGETVEGSQSTVSVVFPTMLNPNNLTYTITSGNNITLNWSPVTYAKSYNVYQII
DGQRVLKQTVTGTTAGFSNMPEGDYTFEVTSASDRFGESQQASTVSLNIVFPVMQAPANF
AYVISNGNYFTLSWATVPYATNYKIYQIINGEKVLKYTLTNTVTSLTFGNMPEGDYSYEI
YSYSNRFGESSAGSNLSFTLVFPTMQAPLNLTSTILNGNDINLKWTAAPYATAYNIYQII
DGQKVFKQTVTTNAVTFTNLPADDYVYEVYSYATRFGESPVGSQIQVSVIWPVVQAPTVT
RNVYNVNNITLTWQKITWANEYRVYEVVGGVNQLLYKGTALTYTAFNVSETTHNYIVTAY
STRFGESVASNQITETIIYPDMQAPNVTVKIVNPTTVQLSWNFITYANGYNIYEIIDGNP
VLLVKNLNNLSYTLYNVSYANHQYFVSAYSNSFGESAPSSTVLAKLIVDTTAPVTSANAQ
TDWTNQNSVNVTLSAVDTETGVANTYYSINDGAFIAGTSFAISAEGITKVSFYSVDKVGN
IEATKTIYVKLDRTAPVTISDVNGNWTKNDVTVNLTATDALSGVYKTFYSIDNSSFAQGT
SFTVSGEGIHKVTFYSVDKAGNIETATTVYVRIDNSAPVTISDLNDNWSKDDVTVNLTAT
DSLSGVYKTFYSIDDSSFAQGTSFTVSGEGVHKVTFYSIDNAGNIETTTTVYVRIDNSTP
VTISDLNNNWSKDDVTINLTATDALSGIYKTFYSIDDADYVEGTSLTVSGSGIHKVTFYS
IDNAGNIEPTTTVYVRIDSSAPVTISDLKTTWSKNDVTVNLTATDALSGVYKTFYSIDGS
DYLEGTSFIVKGEGIHKVSFYSVDNVGNIETITTTYVKIDRTAPTISMNLDGLYKLGSTL
KLSYVVSDNLSGIASEKMLVFAPNDTLGKEVLNGSTIQIDKAGVYKVIVTATDAAGNTVK
IEKQFSVYIVANIQVTAQNIKANNGVFTVRVDMPTEYAGLGFDLDTAKVNGVSALNSNNG
YYNQAKHGQFKFNRSDFSWTSPVQVIQFSCYVNGYLVIGETTVNVKL
Download sequence
Identical sequences D9SUN4
gi|302874070|ref|YP_003842703.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]