SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302874071|ref|YP_003842704.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302874071|ref|YP_003842704.1|
Domain Number 1 Region: 39-204
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000232
Family Fibronectin type III 0.0036
Further Details:      
 
Domain Number 2 Region: 572-727
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000169
Family Fibronectin type III 0.0037
Further Details:      
 
Domain Number 3 Region: 751-908
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000526
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 4 Region: 395-551
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000592
Family Fibronectin type III 0.0047
Further Details:      
 
Domain Number 5 Region: 217-375
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000602
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 6 Region: 931-1097
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000202
Family Fibronectin type III 0.0023
Further Details:      
 
Weak hits

Sequence:  gi|302874071|ref|YP_003842704.1|
Domain Number - Region: 1827-1858
Classification Level Classification E-value
Superfamily PKD domain 0.000549
Family PKD domain 0.015
Further Details:      
 
Domain Number - Region: 1105-1183
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000805
Family Fibronectin type III 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302874071|ref|YP_003842704.1|
Sequence length 1936
Comment fibronectin type III domain-containing protein [Clostridium cellulovorans 743B]
Sequence
MKKHRLSSCLFFVSLLITLQLVFPFVNVFGSPSNTIVLPPSNLTLELTTPSDVKLTWSPI
YGATGYNIYGILDGQITKLSTTTSTSYVINNIAEGDYSYVISTLSGDSESGPCAPVSTTI
DYPTMAAPTNLVSKVQNANDISLTWTSSQYAQSYKVYQLATDGTKTLVSSVNTNSYIAAN
LPAGSYTYVVSAINPLYGESVVSTETKAEVIHPTMAAPTNLTSSIVNGNDITLRWTTTTY
ATSYKVYQIIDGQKVLKSTVASTSASFANMPAGNYDFEVYSFSDRFGESQVGSSTSLSLT
LPTMQAPTNFTYTVTNGNDITLKWNASTYATAYNIYQIIDGQKVLKGTVTSTSATYSNMP
QGDYSFEVYSYSNRFNESPTGAQTSFSLVWPIMQAPDNLTYSIANGNDINLKWSSVPNAK
GYKVYQVINGERVLKSTVATTTVTYANLPAGDYTYEVVSYSDRFGETQTGNTVNVFLVLP
TMEAPANAIQTIKSANSFSLTWDSVPYATSYKVYQIVNGEKVLKSTVTNTTLSFSNMTPG
EYSYEIYSVSSRFGESVNGANVTFNLDGQVLDAPGNLTYTITNGNDITLRWTAVPYATSY
KVYQMVNGEKVLLKTVTTTSVVLTNMAGGDYDIIVDAISTTLGESPVGAETTFSLVLPVM
DAPGNLAYTLKNGNDVVLTWSAVTYGINYKVYELIDGQYVLKTTVTTTTATLTNVSKGDH
TYVVTAVSPRFGETQEGSQTSFTLDFPTMVKPENLTYSIASGNNVTLSWNAVAYAKSYNV
YQIIDGQRVLNQTVTGTSVSFVNMTPEGDYTFEVTSNSDRFGESEEGSQVSLSLVFPVMV
APSNFAYTITNGNYINLKWDIVPYATSYKIYQIVNGEKVLKSIATTNSASFSNMPEGDYS
YEIYSYSSRFGESLDGSRVDFTLVFPIMQEPANLTNTIVNGNDIKLIWNASTYATAYNVY
QIVDGQKVLKQTVTTTTATFTNLPAGNYTYEVYSYCPRFGESPVGSSIDISLVWPIVQPP
TVTRTISNVNNITLAWQKVTWATEYRVYEIVNGVDQLLYKGTALTYVGYNLTEATHSFKV
TAYSTRFGESVASNIITEKIVYPIMQNPTVTAKVVNGTSVKLTWNLINYANGYNIYEIID
GKPVLLVKNLNNLTYTITNASLATHQYVVTSYSNSFGESALSTAKATAIIVDTVAPVTSA
TAEANWTNKSSVTVALSAADALSGVAKTYYSINGGAYVEGTSFAITQEGITKVTFYSVDK
SGNTEAVQTIYIKIDRVTPITTSDINASWSKNAVPVKLSATDSLSGISKTFYSIDDLSFV
EGASFTLQGEGVHKVSFYSVDNAGNAETATITYVRIDSSAPVTTSDVNGNWTNNDVVVNL
TATDALSGVSKTFYSIDDSSFAEGTSFTVQGEGVHKVTFYSIDNLGNTEVVNTVYVRIDN
STPITISDISDNWSKDNVVVSLTTTDALSGVYKTFYSIDDADFTEGTSFTVQGEGTHKIA
FYSVDNAGNIEATTTTYVKIDNVGPTTISDLTDNWYKNDVTVNLTATDALSGVSKTFYSI
DDADFAESTSFTVTGEGTHKVVFYSVDNAGNVETTTTTYVKIDNVGPTTISDLTDNWYKN
DVTVNLTATDALSGVSKTFYSIDGADFVEGTSFTITGEGTHKIVFYSVDNAGNVETTTTT
YVKLDNKGPVTISDIKDSWSKNDVTVNLTATDALSGVSKTFYSIDGANFVEGTSFTVTGE
GTHKIVFYSVDNAGNVETTTTTYVKIDKTGPTVTMNLNDKYDLNATLALNYTAQDALSGV
LSGKILVLKPGDTVATEIANGGSIKLDKAGTYKVTVIVTDAAGNSTTVEKTVTVSAPVTP
PTPTTPDCPYHDHCCGHFRLEVQIFFLYFTIDVCWDKNYNFHATLEFGWNSNYNKSSCSQ
KLPKQISKKAILKLFF
Download sequence
Identical sequences D9SUN5
WP_013291652.1.47838 gi|302874071|ref|YP_003842704.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]