SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302874097|ref|YP_003842730.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302874097|ref|YP_003842730.1|
Domain Number 1 Region: 124-236
Classification Level Classification E-value
Superfamily Cysteine proteinases 9.25e-21
Family Transglutaminase core 0.036
Further Details:      
 
Domain Number 2 Region: 627-710
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 8.24e-20
Family Invasin/intimin cell-adhesion fragments 0.0046
Further Details:      
 
Domain Number 3 Region: 461-542
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 4.32e-19
Family Invasin/intimin cell-adhesion fragments 0.0041
Further Details:      
 
Domain Number 4 Region: 544-619
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.0000000000000392
Family Invasin/intimin cell-adhesion fragments 0.0057
Further Details:      
 
Domain Number 5 Region: 377-457
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.000000000000416
Family Invasin/intimin cell-adhesion fragments 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302874097|ref|YP_003842730.1|
Sequence length 712
Comment Ig domain-containing protein, partial [Clostridium cellulovorans 743B]
Sequence
MSEKYLKSSFIKIALFFLMAFFSLTLTTYAVSNTAATTEELKTNLTSVFKERQTSYSVAY
TGNNLTLKTDIALIIGSIYDSDDYIRYTAKGYSYSYSSNGVTTNITFNFNYWNTLAQDAF
VDTRVSEVLSQIITTGMSDFQKQKAIHDWIVTNVAYDTTLVQHSDYAGLVSPFKTVCQGY
ALLSYKMLNAAGIQTKIIEGTASGVAHAWNLVYLDSAWYHFDATWDDPVPDVAGRVVYNY
YNLTDTQIKTNHTWTKSYPAATTNFADTITSKITSDPTNATVYNEISTALGLNYLSAENT
VNDATELNAKIQDAIKNHLVQIKVRYMKGSTLTTDLSTAIKGISNITSYSYSKTDYVRSS
LTGDILLTLSFTYYDPISVTAVSVSNNNLSLAAGLSSTLTATVSPSNASNKTILWTSSNT
AVATVVGGVVKAVGGGTATITAKTADGGFTATCTITVTQGVSSVTFTPTTAYVKLGGTDV
TLTPSVLPTGATDKSLKWTSSNPSIATVDSTGKVHAVAYGTAIISAISVQDPTKIGKCTV
TVPVPVTGVTVNSTSNYVKMGTPLTLTTAFAPTNATIKTVTWSSSNEAIAKISATGVVTP
VAIGSVTITAKTTDGSFTSTKTLNVVYGVTSVTLDKTIATLKVGGTDLTLVPTINPTNAT
VKTLIWKSSNPNVATVDSNGTVHAVAAGTVVISATSEQDPTKIAKCTITVTN
Download sequence
Identical sequences D9SUR1
gi|302874097|ref|YP_003842730.1| WP_013291654.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]