SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302874098|ref|YP_003842731.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302874098|ref|YP_003842731.1|
Domain Number 1 Region: 964-1046
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 4.71e-20
Family Invasin/intimin cell-adhesion fragments 0.0038
Further Details:      
 
Domain Number 2 Region: 460-542
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 1.22e-19
Family Invasin/intimin cell-adhesion fragments 0.004
Further Details:      
 
Domain Number 3 Region: 121-232
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.72e-19
Family Transglutaminase core 0.06
Further Details:      
 
Domain Number 4 Region: 1133-1214
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 7.85e-19
Family Invasin/intimin cell-adhesion fragments 0.0069
Further Details:      
 
Domain Number 5 Region: 797-878
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 9.02e-19
Family Invasin/intimin cell-adhesion fragments 0.0036
Further Details:      
 
Domain Number 6 Region: 628-710
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 2.04e-18
Family Invasin/intimin cell-adhesion fragments 0.0046
Further Details:      
 
Domain Number 7 Region: 1048-1125
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.00000000000000247
Family Invasin/intimin cell-adhesion fragments 0.0049
Further Details:      
 
Domain Number 8 Region: 545-617
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.0000000000000392
Family Invasin/intimin cell-adhesion fragments 0.0054
Further Details:      
 
Domain Number 9 Region: 881-953
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.0000000000000392
Family Invasin/intimin cell-adhesion fragments 0.0054
Further Details:      
 
Domain Number 10 Region: 713-785
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.000000000000051
Family Invasin/intimin cell-adhesion fragments 0.0057
Further Details:      
 
Domain Number 11 Region: 379-457
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.0000000000000557
Family Invasin/intimin cell-adhesion fragments 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302874098|ref|YP_003842731.1|
Sequence length 1216
Comment Ig domain-containing protein [Clostridium cellulovorans 743B]
Sequence
MSEKSLKFNFIKIATFFLLSFLTLTITTYAATDTASTEAELQTKLKVAMEAKQTTYTVTY
SGDYLQLNTNLTLLIDNILASDDYLHYTFKGWSYTGSSSAGVANLTFTLTYWNTATQDNY
VTQKITEVLSQIITPGMNDFQKEKVIHDWIVKNIAYDTTLVQHSAYAGLVSPYKTVCQGY
ALLTYRMLNQVGIQTKIIEGTGHGSAHAWNLVYLEGAWYHLDSTWDDPVPDVKDRAIHTY
YNLTDAQIKANHAWTLTYPAATTDFANTLKNKLATDSANATFYNTLSSELGLDYLSTNYQ
VNDVSELIVKIQDAMKNHEVALTVRYIPGKTFAADLATAQKAITNLTGYSCSSSDYPRTA
DTNDVILELTLDYYDPISLTAFSISNNTLALSAGASATLTPTFTPSNASNKTIIWTSDNT
NVATVTNGVVKAVGGGTATITAKTADGGFTATCAVTVTQNVSSITINPTTTYVKLGGNDV
TLTANVLPAGATNKSVTWSSSNPNVATVDSTGKVHAIATGTAIISATSVQAPTIVGKCTV
TVPVSVTGITVSSTSSYVKMGGTLALTSTIAPTTATIKTITWSSSNEAVAKVSTTGVVTP
VAPGTVTITAKTTDGGFTASKNLEVIYGVTTITLDKTTAILKVGGSDISLIPTVNPTTAT
YKSVTWTSSNPTVATVNSTGKVHAIKTGTAIISATSVQDSTKVAKCTVTVASPVTGVTVS
ATSSYVKMGATLTLTSTVTPTTATIKTVTWSSSNQSIAKVSTTGVVTPVAPGTVTITAKT
TDGGFTASKNLEVIYGITTITLDKTTAILKVGGSDISLIPTVNPTTATYKSVTWTSSNPA
VATVDSTGKVHAIKTGTAIISATSVQDSTKVAKCTVTVASPVTGVTVSATSSYVKMGATL
TLTSTVTPTTATIKTVTWSSSNEAVAKVSTTGVVTPVAPGTVTITAKTTDGGFTASKNLE
VIYGVTTITLNKTTAILKVGENDISLIPTVNPATATYKSVTWTSSNPAVATVDSTGKVHA
IKVGTAIISATSVQDPTKIAKCTVTVPVPVTGVTINSTSTYVKIGTPLTLTATIAPTTAT
IKTVTWSSSNEAIAKVSTTGVVTAVAPGTVTITAKTTDGSFTSSKVLNVVYGVVTVTLNK
TTATLKVGDTDLILVPTINPTNATVKTINWTSSNANIATVDSNGVVHAVAAGTVVITATS
AQDPTKIAKCTITITK
Download sequence
Identical sequences D9SUR2
gi|302874098|ref|YP_003842731.1| WP_013291655.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]