SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302874190|ref|YP_003842823.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302874190|ref|YP_003842823.1|
Domain Number 1 Region: 370-604
Classification Level Classification E-value
Superfamily PHP domain-like 7.85e-24
Family PHP domain 0.0061
Further Details:      
 
Domain Number 2 Region: 179-256
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.000000000000243
Family Invasin/intimin cell-adhesion fragments 0.008
Further Details:      
 
Weak hits

Sequence:  gi|302874190|ref|YP_003842823.1|
Domain Number - Region: 817-915
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 0.00458
Family STM3548-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302874190|ref|YP_003842823.1|
Sequence length 1588
Comment LPXTG-motif cell wall anchor domain-containing protein [Clostridium cellulovorans 743B]
Sequence
MKIRKNNRILSLSLVLALVFTAIFPGISAKAEGTNTVILEERFDGLSGTSFPNGWTQNAL
SYYDKAASSGKTPPSAKFGTMGSSLTTKEFSLSGNAELSFYIKGNSTSANSALLIEKKSA
EVWATLENIIPIPTSGENKKIQLTSDVTAIRFTYTKDVGNVALDDIVITQIAPVQVINVI
SITVPENIALIEGQNSQIEATVLPTNATNKNVKWASEDATIATVANGKVTAVKEGTTKVT
ATTEDGSKVASCSITVSKKPIVIDTKPQIAHVTPVKGTYTNSEFKPTISAKYTAVNGIDV
TAVKLTVDGTDVTSAATINDSEIVYKPSTNLVEGEHKVTLTVKNKESVQESAEESWNFFV
GQQTKENYNIYYGQLHSHTTDSDGQGTPQDAYTYARDEGKLDFFAVTDHSNSLDNDSACN
ITNGSASTEWTKLHQTADSFNQDNKFVAIAAYEMTWSKGTGGYGHMNTFNSVGFESRNNS
TMDLKKYYDTIAAQPQTISQFNHPGNTFGDFNDFSLYSPAVDNVINLIEVGNGEGPVRSS
GYFPSYEYYTRALDKGWHVAPTNNQDNHKGKWGTANDARTVILAKDLTRDSFYDAIRQNR
VYATEDKNFEVKYYVNNAVMGSTLPNPEKLDISVSFKDNDLTDKVSKVSIIANGGTVVET
KNFDTNEGTWDLQLDSKYSYYYVKVEQADKDIAVTAPVWTSEVTPVGISKLEVSQNPQIV
NKVTDFTATLYNNGSQELNNVKVEYFKNSITQENKLSEETIASIAPAGVVSSKLAWTPSS
AGNYNIYVQMTVNVSGTDKVFSQSIPFNVFNEGEIAKIVIDAGHYNQYVSGQYKNSILGL
DKLVKAKNMMLVQNTDELTSSDLEGVPMLLITDPQGYIDTKNALTSSKFTAAELEVIKNY
VQNGGTVVITSRADYDDKKVKDGDEYQNSVQGNSVLEAIGSNLRFNDDEVVDDTVNGGQN
YRLYFKNYLSSKFGLTNNIVDGYTYSAYSGCSVVLKAGGNDANVDWLVKGHDTTYSLDSD
GGLDAVAVNKGDIYSLAAEKLPSGGKVVVAGTTFFSDFEIQATDNAYSNSTIFNNVLAWA
TMPKQVDIAEIRKDENKDGVYDNLGKRFVVEGTVTSASTKAVKNTAFFDCMYIQDATGGT
NIFGLAKKAIPLGAKVRITGTVKEYEGDLELGINDENTDITVIDSNVQLVNPTELTTKAS
MLKENQGLLIKVQGKVTKLTDNEIFLDDGSGVARVYLNGYIGDETDNPTGKWDSTIKVGD
TVSAIGLGSEDTVGTRLRVRNSSEIKKVSSGTKPTDPTNPTDPANPTDPTNPTDPTNPTD
PTNPTDPTNPTDPTDPTNPTDPTNPTDKPSTVTIDNNVDKNAVIEAIKDATTIYVKTSKT
PVVSKDVFNLVKGTNKTITFIGDKVTWTMKGFDINAEVATDIDLSLKTITDDLKNNMIKA
YGKGANISPFSFAYDGALPAMTSIKVYVGTEWSNKVVNVYRYYPGDDKVELIKEKVTVDS
EGYITYEANHCSDYFVTEVGTKIPDENKNPGVQNPTLVAPVTITTNVAEGLPQTGSSFNE
AVLVKLGALLMIGGALIVLYGRRKKETN
Download sequence
Identical sequences D9SVD5
WP_010076081.1.47838 gi|302874190|ref|YP_003842823.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]