SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302874226|ref|YP_003842859.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302874226|ref|YP_003842859.1|
Domain Number 1 Region: 62-201
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.13e-19
Family CBM4/9 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302874226|ref|YP_003842859.1|
Sequence length 205
Comment Carbohydrate-binding CenC domain-containing protein [Clostridium cellulovorans 743B]
Sequence
MGLQFMKKKFKTAVAAVVLASSVTGYNIAKEDDIVALDLKKSSLESMDYSKEKIEDISEN
LVKYGTFSESPECFKHWRVVVDNIAICTYENSNDVFSLEPEDCGNSEDAIQLCQTIDNIE
PGKKYTLNFKAKSTLPKSITVFISDRMDVLSFSKPATYSISDKWTDYTYDFVVSENTEPL
SVLRFYLGRTMGKISFTDIKLNLSS
Download sequence
Identical sequences D9SVH1
WP_013291664.1.47838 gi|302874226|ref|YP_003842859.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]