SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302874261|ref|YP_003842894.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|302874261|ref|YP_003842894.1|
Domain Number - Region: 99-216
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 0.0051
Family Hypothetical protein YteR 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302874261|ref|YP_003842894.1|
Sequence length 456
Comment hypothetical protein Clocel_1377 [Clostridium cellulovorans 743B]
Sequence
MKYIGPFLRINTLNKSNISNQLFHFSKESLKHIVLYSKCGIMIKPKDLTVKNISNNDINI
INNISPLLCVYKKSSSRLKLEGKRFTFNDETFKREIIIRANGFMTLSLLDLCEYYRDFQD
NDLQNLYKLYLSMAKDQLDFYASHLRNSQGVFVDKKDLSDSISNEFKLEQKRSSFKFSDQ
ALLMCAYYKYSDLSSEEDSSMYRDFSYDILKMFLDYKSEIYPQDCEELLDICFALNLFYE
LSRNKDTLNLSMDLEEYICDNYLHVIDNSFNHLNKLLLNTTDLSNYSDLDKYKELNKTLY
ERLLDYYDDENSIFMKKNDDLEYNCEESVLYLLNCIRNCTEKQEYIISNVFRNLLLDSGL
ILSWPDAPNLDSPERYINESMKSEDMIEEENYKMMSMGTPESTNFAPIFIKRVKFNKKRK
KFKKYSNSFDSKKNLFLYYILLHYQKPKHKKQFLNQ
Download sequence
Identical sequences D9SVK6
WP_010076006.1.47838 gi|302874261|ref|YP_003842894.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]