SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302874304|ref|YP_003842937.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302874304|ref|YP_003842937.1|
Domain Number 1 Region: 315-772
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 9.72e-102
Family Cellulases catalytic domain 0.00000628
Further Details:      
 
Domain Number 2 Region: 35-227
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.4e-35
Family Family 30 carbohydrate binding module, CBM30 (PKD repeat) 0.000003
Further Details:      
 
Domain Number 3 Region: 204-314
Classification Level Classification E-value
Superfamily E set domains 4.48e-17
Family E-set domains of sugar-utilizing enzymes 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302874304|ref|YP_003842937.1|
Sequence length 1027
Comment LPXTG-motif cell wall anchor domain-containing protein [Clostridium cellulovorans 743B]
Sequence
MKKRFWSILLLVMVFIISNQPITNAVVKAETSRQLCDLQIFKDKAPAGWCGSGNGELETQ
NDMLPVDTAVICNGLPSLKFNVSKQIDTWMSAQLAIRDWNAHDLTQYLPNGYIEFNIKGN
IGGEDVLIGAKDIVHERNDASGNPLENVELYQPISKYATITKEWQHLKIPIKDIIDETKG
FVTKSAQALLIASATGQPLTVWVNDFKITSTDNEKGFAKIKVNQVGYLTYGEKCAIVSGF
ADELKADTNTEFQVKNAVNNATVYTGKLTLVKEYDSTDSGEKVLQADFSAVTTPGSYYVT
VPAENMEKSLQFKIGNDVYTSLLADSARYFYYQRQGIDLQEKYALAYPRKESTPQDSTAI
FESNPNKVIDVSKGWHDAGDKGKDLLNGALAVSDMFWAYEMFPSTFKDNQFNIPESGNGI
VDVLDEARWELEWILKMQDSASGGFYARVKSDTFPAEQVVNQRIICDKSGDIGDIKSTED
TACAAAILSHAYIMYKDIDAKFANQCLDSAKKAWTFLENNPKTITSPPGPYNVYDDSSDR
LWGAATLFRVTGDEKYNTYFKNNYQKFSEKFESKESYGHNWGNMWTTAFWSYLKAEKKDA
NVESWIKIEFNVWLKNVMERYNDSAWKNTIVKTNVDGESKADYFWGCNSDIMHVSNDAVI
GSKLLGTYDNSIGAFARSSLNWILGMNPQRKSYVTGYGEDSIKTIFSYLYSYDNRAGVPV
GYLAGGPNYSQGKGISKFPGKCYMESDHDWVSNENCLNWNAPLVFVSAFVNDEAYQPKED
VKKPEDEKKPTNNDKLIVEKNGTSAIVTVPAGMINRDALTVINPGLLSDITTVETRVPTS
AIVGGQGQLQFITSNSNVTLPIGAIDFTGIGDGSYLAFTQSVKINDPILAALRGAKQIFE
FDASINDKDGNKVRDIHKFKDGKEAMISLQLDEKDISDLDKTKMAVWYYNPITGKLEKLG
GHFEDHTKKIVFYTSHFSQFVVGEDSELDETLPQTGSINNITSLVALGLVMTIAGIMLIL
RKRENMK
Download sequence
Identical sequences A0A173N0D6 D9SW29
gi|302874304|ref|YP_003842937.1| WP_010075961.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]