SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302874339|ref|YP_003842972.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302874339|ref|YP_003842972.1|
Domain Number 1 Region: 41-354
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.31e-72
Family beta-glycanases 0.00000845
Further Details:      
 
Domain Number 2 Region: 364-445
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.0000000000000275
Family Invasin/intimin cell-adhesion fragments 0.011
Further Details:      
 
Weak hits

Sequence:  gi|302874339|ref|YP_003842972.1|
Domain Number - Region: 672-771
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00714
Family Family 6 carbohydrate binding module, CBM6 0.037
Further Details:      
 
Domain Number - Region: 932-1041
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00884
Family Family 6 carbohydrate binding module, CBM6 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302874339|ref|YP_003842972.1|
Sequence length 1381
Comment LPXTG-motif cell wall anchor domain-containing protein [Clostridium cellulovorans 743B]
Sequence
MGNKRNKSILSIFLSMLLILSMSINVPRAMAVQALTIPGYASGADVSWIPQMEASGFVFR
DENGNVRDCLDILKEKGIDSIRLRTWVNPSNDPQAGHCSTLETVAMAKRVVDKGFRLMID
FHYSDSWADPGKQVTPAAWQNDNIDQLTTHVYDYTLEVMNALKAEGITPEWVQVGNEINP
GMMLPLGAEGDFVNLTRLINAGYDAVKAVAPNAKVIIHRANGDKTNEFQRFFDGLTAKGA
KYDIIGCSVYPGSNYMTYMDNLRINLNNLVNRYNKEVMVVEIGGEASNPTASYNMIIAAR
DIVQSIPNNKGLGVFYWEPQGAQSWSGYALSAWNGYNTPSQPTDGQPTIAMNAFIPGATQ
INPVPVTGLTLDKTSVSMEVGATTKLTAIVEPSNATFNMAKFSSSNEATAKIDPNGNVVG
VSVGTATITATTYDNSKSVQCQVTVNPSTALVTNSSFELGTSGWTVTGSGISLGENNGYD
GSTGMHYYSGQPFNGTVSQTISNIPNGSYKLTAMSQGGGGETNSEVFATLSNGQKLASNF
TNIGWQNWVKTTVNDIQVTDGTLTVGFYINAPGGVWGDIDALVLAKTDGSTLTDLKVNGV
TVKGFDSETLTYNVVLPAGTTLVPEVTATKAITNATAVVTPATVVPGQTKVVVTAEDGIT
TKTYTINFTVANPNPIQNPGFEDGYTGWTITDETAVSSSNDKRSDSKALGYWKSGAFTVT
ASQVITGLQNGTYSLSAWSQGGGGENTVQIFATNAQNVKATADFTNTGWCVWSKATIPNI
EVTDGTLTIGAYVDGKAGNWGGFDDFELIQTSVSESKSTDATLSDLKVNGATVAGFDSNN
TSYRVELPAGTTAIPEVIAAVTAMGKATAVLTPAASLPGQTTVAVIAEDGTTTKTYTIDF
TVAAATLVQNPGFENGYTGWTITDATAVNESKDAKAGSKALGYWKDGDFTVAASQVITGL
QNGTYSLSAWAQGSGGENKVQIFATNSQNVKATADFTNTGWGAWTNAIIENIEVTNGTLT
IGAYVDGNSGNWGSFDEFQLVQTSVATPKSSDATLSDLKVNGTTVTGFESNTTAYRMELP
SGTTTVPTVLGTVTATGKATAVVTPATNLPGQTTVEVTAEDGTTTKSYTINFTVAVVVPD
PTPDNTIIPNTDLAAVLNAVKNAGEKSTVMVDVSSNKEISKEIFAAIQGQDKTVTFVQDG
VQWSFNGKDITEEIKAIDMTVVVDSLTDTKSANKDGISKLVGDNDTLVISFAENGVLPGK
ATVRVKLDSAWLQGKDTNNLSIYYYNETTGKAELIAEGLKVDADGYVQFEITHNSDYFVV
DKQIADTVTVVTDSNSTSNVSTVVLPQTGSQIDYTVLMSIGALVLLCGVAMIGLRRKSKQ
K
Download sequence
Identical sequences D9SW64
WP_010075925.1.47838 gi|302874339|ref|YP_003842972.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]