SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302874358|ref|YP_003842991.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302874358|ref|YP_003842991.1|
Domain Number 1 Region: 283-721
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 1.4e-111
Family Cellulases catalytic domain 0.000000205
Further Details:      
 
Domain Number 2 Region: 29-177
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.61e-30
Family CBM4/9 0.011
Further Details:      
 
Domain Number 3 Region: 188-281
Classification Level Classification E-value
Superfamily E set domains 7e-17
Family E-set domains of sugar-utilizing enzymes 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302874358|ref|YP_003842991.1|
Sequence length 724
Comment glycoside hydrolase family protein [Clostridium cellulovorans 743B]
Sequence
MRKKFITALIAGAVLFGGFGSYQAAAADMTVNLIENGSLDTNAKGWGGFTTEGGGGYLTY
DDGGIKAEVTNCGNAPYSIQIYKDDFKMYKNGKYHLEFDVSSTVDRTIQYTIQLNRGDYR
YYVEDKINTTQEVKTVSQDFVMTEETDMIPRLAFNVGNVVGENLGNHSVKIDNVKLFLVD
VSGIKEEIESPKVEQKIVLNQIGYKPEDKKKVVFRTETNDRNFRVVSTKTNEVVYQGDIY
GRTYNETAGEINSFGDLSSLKTPGTYRIETDSFGSSYQFTIAEDVYKNLFKDAMRFFYFQ
RCGQELTQDFAGTWAHPACHQQLATIYGTDQKIDVSGGWHDAGDYGRYVIANSKAMADLF
TAYNDNKAAFGDDFNIPESGNGIPDVLDELKYQLEWMLKMQEKTSGGVYHKVTSWDFPGY
VMPQEETGELLVCPISTPATADFAAIMAMGYENFKDIDPALASTCLAAGEKAWAYLEKTP
NTPFSNPPGVLTGDYADGYDGDERYWAAAQLFKATGDSKYDQAFRTMLNTKYESGFLWSN
VGHYGNLAYIAAAGADQNAAGNIKNRIIDEAQDIVAFSRNDGYNSSTPSYFYYWGSNAKM
NNNAMLLANAYKISNNPEFLEYAKEHVNYCLGKNSLGKCFITGYGTDGVETPHHRPSMAQ
GKALPGMIVGGPNKYLEDPTMKLGLTEEAPARCYLDDSECFACNEVDINWNSPLICAMSE
LNMK
Download sequence
Identical sequences D9SW83
gi|302874358|ref|YP_003842991.1| WP_013291671.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]