SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302874360|ref|YP_003842993.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302874360|ref|YP_003842993.1|
Domain Number 1 Region: 284-721
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 4.33e-119
Family Cellulases catalytic domain 0.000000132
Further Details:      
 
Domain Number 2 Region: 31-180
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.23e-33
Family CBM4/9 0.0025
Further Details:      
 
Domain Number 3 Region: 194-283
Classification Level Classification E-value
Superfamily E set domains 4.76e-19
Family E-set domains of sugar-utilizing enzymes 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302874360|ref|YP_003842993.1|
Sequence length 724
Comment glycoside hydrolase family protein [Clostridium cellulovorans 743B]
Sequence
MKKRLLTALIAAVVFTGSYASFSTGIKAGELSGTTVINCNFDTNMKGWSYFTASGGDGEV
TLADGALKAQVNECGEVSYGVQAYYDGFKMYKNGTYRLEFDISSTTDRIVDYRIQLNGGD
YRAYVDGQINTTSAVQSISKEFVMTEENDVAPRLAFNLGSITGEALPAHSVKIDNVKLVL
VDDTGVVGIEKPKVEQKIVLNQLGYKPNDKKKVVFRAETTDRNFKVVSTATNEVVYTGNI
EGCRYNEAAGEINRFGDFSSFTTPGTYKIQTDSLGSSYDFTISEDIYNNVFKDAVRFFYM
QRCGQELPAIYAGKWAHPACHTELARIYGTDKKIDVSGGWHDAGDYGRYVVATSKAVADL
LSAYNDNKAAFGDDFNIPESGNGVSDVLDEVKYQLQWLLKMQEPTSGGVYHKVTCAGFPG
HIMPQFEKDALIVSPISTTATADFAAVMAMGYENFKDIDAELAQKCLAAGELAWSYLEKT
PTIPFTNPKGISTGEYGDGYDGDERYWAAAELLKATGNSKYDDAFKKMLNLKFENGYGWA
SVGHYGNKAYLTAKAADQNVAGNIRNHVLNEAQQIVSLAKNDGYNISNGTNYYWGSNMNV
TNNAILLAEAYKLSPNPEYLEYAKEHINYCFGKNSLGFSFVSGYGTDYLKNPHHRPSIAQ
KAAIPGMLAGGPNDNLEDPYAQGILEGQAPARCYVDHAESYSTNEVDIYWNSPFVYAMAA
LNMK
Download sequence
Identical sequences D9SW85 Q6DTY2
WP_010077571.1.47838 gi|302874360|ref|YP_003842993.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]