SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302874500|ref|YP_003843133.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302874500|ref|YP_003843133.1|
Domain Number 1 Region: 203-530
Classification Level Classification E-value
Superfamily Pectin lyase-like 8.2e-54
Family Pectate lyase-like 0.00063
Further Details:      
 
Domain Number 2 Region: 849-1222
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.88e-49
Family Pectate transeliminase 0.0000219
Further Details:      
 
Domain Number 3 Region: 1279-1337
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000000392
Family Type I dockerin domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302874500|ref|YP_003843133.1|
Sequence length 1338
Comment Pectate lyase/Amb allergen [Clostridium cellulovorans 743B]
Sequence
MKKRSKGNKRMKKVPERVLVAALASSMVVTPLINANSQTYSVFAAALEAAESTATQVNIL
ESNGWLESAHVEWSAVAGASGYNVYYKSATASDSGYQKIDSQLIRKYPTYFRADVLGLAQ
GDYVVKVVPIINNSEVASAQAITSTLSVKSHVREGFAFAKESPAKTSSGGYNDDGTIPSN
AQIVYITADTASTVTADVITSSNGTTTTCKGVADILSKRQKAYDKRPLIIRVIGQIKASD
ITGLNSTGYLQLKGIYNVTFEGVGDDATAYQWGMLVRDAHNVEIRNLGFMLFPDDGISLD
TGNDNIWVHNNDIFYGSAGSDADQVKGDGSSDVKGKSTYVTIAYNHYYDSGKCSLCGMND
TENFYVTYHHNWFDHSDSRHPRIRVGTIHIYNNYFDGNAKYGVGVTKGSSAFVENNYFRN
CKYPMLTSLQGSDIYNDPEGTFSGEAGGMIKAYNNTVEGAKRLVYSSEDATQFDAYLATT
RNEAVPSSYKTVSGGTTYNNFDTSSIMYSYKPDAVEDVKNVVTTYAGRVEGGDFIWKFTT
ADDTNDTIDAALMAKIKSYQSPLVASTGGTTTPTTPTTPTTPTTPTTPTTPTTPTTPTTP
TTPTTPSTTVQKLNVTSDIAAGSYTTSTTVNGFTLLGSATYPLTVDSSSKECAGNSYTLR
LKTNGTGAEGKRSIQFTAANSGKLIVHAISGGSADRPLALSKGGTIVSSTTIGYSALNEY
VIDIPSAGTYEIFANDGGGINFYYLEVTASSTSGTTTPGTGTTTPGTGTTTPGTGTTTPG
TGTTTPGTGTTTPGTGTTTPGTGTTTPSTGTTGTHGTSTGIGSKADSEFANAIYCSPTAT
SAGTGTKESPMAIESAIANVKAGGTILLMDGTYSFSKQLTLPVGNDGTASAYKTIKACQG
AKVTFDFSAESYDMADPSKNDRGIQMEGNYWHLYGVRVTGAADNGVFVCGNNNIVEYCVF
EANRDTGLQISRRASSLATIDLWPTNNLILNCTSFNNSDTATGENADGFAAKLTCGTGNV
FDGCISYNNVDDGWDLYAKTETGPIGAVTMKNCIAFRNGQTTAGQYTANSDGNGFKLGGS
GIANDHAVINCISFENKNHGFTDNSNPGTITVENCTSFNNSQADGGKSNFDFARVATSHN
IFKNLVSFSNTKVSSDKYIGVATNCSFQNGGKYYLIGDTQNVNSTASATKGTLNTAGVTA
ADFVSIKSPALGADVHTLWRNADGTVNTQGFLMIAPTSAYNTKGAVFGASTTSTNPTTPT
NPTNPTNPTNPTTPTTPTTPLVGDLSKDGKVNAIDLAFLKKLILSGDTSGADMTVADMNK
DGKINAIDLALLKKQLLS
Download sequence
Identical sequences D9SX08
gi|302874500|ref|YP_003843133.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]