SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302874501|ref|YP_003843134.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302874501|ref|YP_003843134.1|
Domain Number 1 Region: 313-756
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 4.16e-102
Family Cellulases catalytic domain 0.0000052
Further Details:      
 
Domain Number 2 Region: 34-226
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.11e-47
Family Family 30 carbohydrate binding module, CBM30 (PKD repeat) 0.00000076
Further Details:      
 
Domain Number 3 Region: 200-310
Classification Level Classification E-value
Superfamily E set domains 4.55e-20
Family E-set domains of sugar-utilizing enzymes 0.001
Further Details:      
 
Domain Number 4 Region: 761-826
Classification Level Classification E-value
Superfamily Type I dockerin domain 4.45e-16
Family Type I dockerin domain 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302874501|ref|YP_003843134.1|
Sequence length 826
Comment glycoside hydrolase family protein [Clostridium cellulovorans 743B]
Sequence
MKNKKIMGLVLAASLTASVFTPILSVNADTTVSRKLMDLEVFKSASITGWSGSAGGELEV
ASDSNLPIDTSATYNGLPSLRLNVTKASAQWWSSLLTLRGWCTQDLTQYLANGYLEFNVK
GKVGGEDFQIGLQDQTHERAAGDSVTSVKSIKNYVNISTNWQHVKIPLKDIMGPSTGFDP
TTARCINIVKGSSEIFTAWINDLKITSTDNEKSYAPIKVNQDGYLPSSEKYALVSGFSDE
LNANAGSQFQVKDATTNAVVYSGTLTLASSFDSDSGEKILKGDFSSVTTPGTYYISVPDA
GNSNSVKFKIASDVYKNLLFDSQRYFFYQRQGIELKAPYVTDYPRTDETPNDAIAQFESG
TQPAREITKGWYDAGDKGKYINNGALAVSNMFWAYEMFPETLKDNQFNIPESGNGVVDIL
DEARWEVEWILKMQDSVSGGFYARVQSKDGKDGDSSAPRIIKDGSTNIKSTDDTACAAAI
LAHSYIMFKNIDPTFANKCLEAAKSAWSYLEKNPTNIVSPSGPYNVYNDSSDRLWAAASL
LRATNEDKYNTYFLNNYSKFSTYFRDANGYGHNWGDMWTTAFWCYLKADKKDSNAVSWIK
TEFSTWLDNKISRTSTNPWQISNPTGSFFWGINSNILLTWEDAIIGSKLLGTYSDTIAKQ
TQASLNWILGVNPLRKSFVTGHGEDSTKKIYHVTYSADGKAGVPNGYLAGGINASEGKTL
SNFPGKCYIDSDGDWVTNENCLNWNASLVFISTFVNSSTPTSYKLGDLNNDGKINAIDMA
LMKKGILGGFTDSATQLAGDVNKDGKTNAIDLALIKKYILGQINSF
Download sequence
Identical sequences D9SX09
WP_010077421.1.47838 gi|302874501|ref|YP_003843134.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]