SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302874678|ref|YP_003843311.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302874678|ref|YP_003843311.1|
Domain Number 1 Region: 47-453
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.26e-62
Family Pectate transeliminase 0.000000394
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302874678|ref|YP_003843311.1|
Sequence length 454
Comment hypothetical protein Clocel_1803 [Clostridium cellulovorans 743B]
Sequence
MLKHSKVKSLILGAAVFSAMSFSTMPIQSNLVMAAENTNVAANETVIESAIYVAVYGNDS
SAGTKEAPLKTLSYAVSIANPGTTIYLRDGLHKYSSTINLNKVGTETNPINIFAYPGEKP
VIDFSAQSYGASSRGFSLTGSYWHLKGLEIQYAGDNGIKIEGNNNKIENCITHHNGDSGI
QLGFAHETVNPNGALCANNEIINCDSYFNFDFDSSGGDADGFACKMHNGKGNKFINCRSW
RNSDDGWDLYETDWGVEIINCWTWHNGDKTDFDAIYQKKMGRKMSSYQGNGNGFKLGGNG
AGGSSKGVHVVKNCVAFDNYLRSKKGFDQNSHAGSVIVQNCLSFGNGYNYMFETASNMEF
SNNVSFGAKVKLDHEIASGSIEKNNTWNLKITTDASDFTGLTEDLAKAPRNSDGSLPNNG
FAKLAANSDLIDKGVAIGLPFLGTAPDLGAYELR
Download sequence
Identical sequences A0A173N034 D9SL31
WP_010077238.1.47838 gi|302874678|ref|YP_003843311.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]