SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302874822|ref|YP_003843455.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302874822|ref|YP_003843455.1|
Domain Number 1 Region: 137-428
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.74e-52
Family beta-glycanases 0.00026
Further Details:      
 
Domain Number 2 Region: 7-123
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000162
Family Family 6 carbohydrate binding module, CBM6 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302874822|ref|YP_003843455.1|
Sequence length 457
Comment mannan endo-1,4-beta-mannosidase [Clostridium cellulovorans 743B]
Sequence
MTRDTFIISALECTYTNGTIKTNLLDKGSKKFIDILNNDGDTVEFIFDISKTGFYKLSFD
YSLPTENAVHRCLINDEFYGDLSFKQTEKFILLNTITSIKLEQGKNKVTLLRSWGHLNLR
SLVVDETEAPAAFNPTFALTNPKASKESLELMNFFKKIHGKRILSGQHCNKSTCPDFEFI
KRKTGKFPAILGFDLLSYSSAIDTKESSWDCIDEIANNRGSVEVALKYAKETNCIITFCW
HWFSPLHGRDKSFYTENTTFDIEKALSPDSLEYMSMIKDMDMIADQLKLFKAANVPILFR
PLHEAHGSWFWWGAKGPKPYIELYRLMYDRFTNLHQLNNLIWVWNATFEEYYPGDDVVDI
NSRDIYGPMKNYGPLTYDFYETALIPTPSKPMALGENGSIPNPNLIKESNTPWLWFMTWN
NFLNNDYNELDKVIEFFNDPHVINLEDLDSYFPAKYI
Download sequence
Identical sequences A0A173MZX2 D9SLW0
WP_010077090.1.47838 gi|302874822|ref|YP_003843455.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]