SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302875153|ref|YP_003843786.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302875153|ref|YP_003843786.1|
Domain Number 1 Region: 32-234
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-78
Family Xylanase/endoglucanase 11/12 0.00000019
Further Details:      
 
Domain Number 2 Region: 303-504
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 3.71e-52
Family NodB-like polysaccharide deacetylase 0.00000175
Further Details:      
 
Domain Number 3 Region: 245-305
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000000245
Family Type I dockerin domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302875153|ref|YP_003843786.1|
Sequence length 520
Comment glycoside hydrolase family protein [Clostridium cellulovorans 743B]
Sequence
MKQKMRIVFSMLMCITILLASSAVGVLAATKTITSNETGNFEGYDYEYWKDNGTGTMTLT
GGGTFSCSWSNINNILFRTGKKLGSTKTYKDYGKISINYDCNYQPNGNSYMAVYGWTEDP
LVEYYIIDSYGTWNPGSNSTLKGTTTVDGRTYQIYQNSRTGPSIKGNNTTFQQYWSICTS
KRTSGTITVSDHFKAWENLGMKMGKMYEVSMVVEGYQSSGKADMTKMDLIMGDTPPVIVD
QPTPEKLLGDVDNNGTVNALDLAIYKKFLLGMIPSLPATGDVDQNGRMNAIDFAMIKQHL
LGIIKLGKLPTTSEDPNKKLVALTFDDGPSSQTGLVLDKLKKYNAKATFMVIGNKISSAD
AIMKRIVSEGHEIGNHGWSYDSMANMSASQITQEINQCNSAIKQYTGSDPKFFRPANLAT
SQTLFQTVKLPFVQGVIAQDWNGASATTAEARAQLVLNGTQDGSIVLMHCTQPGYHPTPE
ALDIIIPQLQQQGYSFVTLSDLFKLKGKTPQLGTMLNGAF
Download sequence
Identical sequences D9SP57 Q8GH59
WP_010076738.1.47838 gi|302875153|ref|YP_003843786.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]