SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302875156|ref|YP_003843789.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|302875156|ref|YP_003843789.1|
Domain Number - Region: 40-106
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.00384
Family Invasin/intimin cell-adhesion fragments 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302875156|ref|YP_003843789.1|
Sequence length 114
Comment hypothetical protein Clocel_2299 [Clostridium cellulovorans 743B]
Sequence
MKNGLKKLICSALVCATVFVSQAASVSAIGLQNNVTKSPIASAQYISNYYTLKVGQTQYL
TGYSYSAYSSSNCATIETFGSMVLVNAKAPGTIVVYAYNENDSLRTVNYITIQW
Download sequence
Identical sequences D9SP60
WP_010076734.1.47838 gi|302875156|ref|YP_003843789.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]