SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302875378|ref|YP_003844011.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302875378|ref|YP_003844011.1|
Domain Number 1 Region: 457-768
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 2.3e-64
Family alpha-L-arabinanase-like 0.00000459
Further Details:      
 
Domain Number 2 Region: 33-234
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.69e-35
Family Clostridium neurotoxins, the second last domain 0.014
Further Details:      
 
Domain Number 3 Region: 348-415
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.0000000902
Family Invasin/intimin cell-adhesion fragments 0.0095
Further Details:      
 
Weak hits

Sequence:  gi|302875378|ref|YP_003844011.1|
Domain Number - Region: 882-969
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.00011
Family Invasin/intimin cell-adhesion fragments 0.015
Further Details:      
 
Domain Number - Region: 260-323
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.00051
Family Invasin/intimin cell-adhesion fragments 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302875378|ref|YP_003844011.1|
Sequence length 1239
Comment LPXTG-motif cell wall anchor domain-containing protein [Clostridium cellulovorans 743B]
Sequence
MLKKFLGCLTAFMVTINTVSVFPAVKAVTVDTLQNGLVLNYAFNDIVNNKVVDISGNSND
GTVFGNATINTQGKIGSSLNLDGSSYVKLPNGLLDNLSDITVSTWVNYESNSFDWARVFD
FGQDANNFFFLSKNKHVGLNVNSTPQDLAPAGVQVNNQWVYVTVTLSNNTLIYYENGVEV
ARKTDATNKPSGIVGSTENYIGKSKFNDPLLIGQMDEFRIYNRALSATEVSSLSTLVQEQ
STVEVYGAGNENKINTIGGTLQMTAVVRPTNEAVNWSVVNLDGTSTDLATIDSNGLLTGA
KVGTVMVVATAKSNQAVTGSAKIAITQKVDSLSLSGAEGKNSIDTKAGKLQMISSASPSN
ATDTSVAWSVTDTNGNITNIASIDTNGILTARKDGNVVVTATAKDGSGATAKMTVSITGQ
AYVANEKLAAIAPQAPNEPLLYDVPNINNEAAWGTSNTHDPSIFKDGDWYYVFSTDYKVG
GPTGVGLQVRKSQDLINWQWVGRVFNEIPAAAKAWSPNAENMWAPDVVKLGDTYYLYYTV
SAFGTNTSFIGLATSKSIEGPWIDQGEVYKTKLGVDTDNALDPNIVTDANGDLWLSYGSF
FSGLFVSKIDTTTGKLLTPGKGTQISASGTRKNMEAPYIVYNPQFKKYYLFMSYDDLAVD
YNVRVAWSDSITGPYTDLSGNSMMNTPTDRDALYDIGTKLIGSYAFGTDPGWIAPGHNSV
LNDNGNFYLVHHARGGADKNWSYLQVRKIVWSAEGKPMVSPERYAGEVEQKIDQSLIPGK
WQTIVQNRLNNNKLTSTDITLYPNGKINDENGQSYWELTGDNTVTLNYYAPGVAPGDYWV
DTVKVLPAWDYENWAPTVVFTGYNQGNTAVWGKQVESIVTKVTGITVSTGDNVLNITEKG
GSLQLIATVNPTYATDASVTWSVVGLDGNATDLATISETGVLTAVKDGTVKVVALANDGS
NVSGVAEVIISGQATTTGGDNTDGTGDDATGGDNTGDIEKIIIKPVVDNVLPVVVNVIDN
KNGDTVITLAKEAMDVLTEVTINDINSIKDGTGNLVINLGSDMYIKLPYEVIDKSLLKDN
SKVIFRTTIKENSDLYKDLKGINKVFSFEMLVVNGTEETVIHQFASGLVEVSVNLTDEQL
NGLDKNKLVVLYYNDVTKSYEEMETTIDGNKITFKTPHFSDFIIAEKTQATGTSNTSNTT
SVILPQTGSFVDSSLLLVAGLIIILSGLGIVLISRKKDA
Download sequence
Identical sequences A0A173N0B1 D9SQP1
gi|302875378|ref|YP_003844011.1| WP_010075488.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]