SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302875379|ref|YP_003844012.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302875379|ref|YP_003844012.1|
Domain Number 1 Region: 1349-1660
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 9.95e-65
Family alpha-L-arabinanase-like 0.00000764
Further Details:      
 
Domain Number 2 Region: 297-630
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.48e-64
Family beta-glycanases 0.00068
Further Details:      
 
Domain Number 3 Region: 928-1128
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.75e-35
Family Trypanosoma sialidase, C-terminal domain 0.037
Further Details:      
 
Domain Number 4 Region: 158-309
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000623
Family Family 6 carbohydrate binding module, CBM6 0.042
Further Details:      
 
Domain Number 5 Region: 722-816
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000117
Family Alginate lyase 0.074
Further Details:      
 
Domain Number 6 Region: 1237-1308
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.0000118
Family Invasin/intimin cell-adhesion fragments 0.014
Further Details:      
 
Domain Number 7 Region: 2-45
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000691
Family Leech intramolecular trans-sialidase, N-terminal domain 0.064
Further Details:      
 
Domain Number 8 Region: 1783-1860
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.0000902
Family Invasin/intimin cell-adhesion fragments 0.015
Further Details:      
 
Weak hits

Sequence:  gi|302875379|ref|YP_003844012.1|
Domain Number - Region: 1177-1216
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.00392
Family Invasin/intimin cell-adhesion fragments 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302875379|ref|YP_003844012.1|
Sequence length 2130
Comment LPXTG-motif cell wall anchor domain-containing protein [Clostridium cellulovorans 743B]
Sequence
MLRGKIDDFRIYNRALSSDEVYSLMMQSVTDTELVANAKSSLELGDLSEVTSDLQLLKTG
DKGVTIAWSSSDEAVINNDGIVTNPSGSNSAEVTLTATLSKGNAVDTKTFTATVLPSGVP
NYLLDVNVDKEKFDISDTLVGLFFEDINHGADGGLYAELVENSSFEFKTSLDSWTIDKKG
TSNGTLTVKNVNPLNSNNTHYLEFDSTAAGDGFRIVNDGYKGISIKKDSVYDFSVWARDV
DNTSGDLLVRLEAEDGTVLSNTVTINGFTNNWTKYEGTLTANSDTLKAKLVVYKKDAGKI
NLDMISLFPQDTWKGRKYGLRKDLVQLIDDMEPKFLRFPGGCVIEGSTKENMYNWKDTIG
NVEERKLNENIWGYYQSYGLGYYEYFQLCEDLGAVPVPVVNVGMTCQARGVNGVSSYLVP
LNELDKYIQDALDLIEYANGDVTTTWGAKRAASGHPEPFNLKYLSVGNEQWGNDFYVRFE
AFQSVLKVKHPEITLISTSGPSASGTEYTNAWNWIKQKANDTIVDEHYYMDPQWFLENTH
RYDNFDRNGAKVFIGEYASKSNTLKSALAEAAYLTGIEKNSDVVKMASYAPLFAKDDDTQ
WSPDMIWFNGAESYATPNYYVQKLFSTNTGTQLLESSMNRYKTIEDDIKGGIVLGSWMSG
VEYDDVVVKDNTTNQVIFSDDFSTAKTDWKKGTGNWTVKDGKLVLTDLLEDCRTYINNDK
WQNYTLSVKAKKTSGNEGFLIGVGARDTSNFYWLNIGGWNNSRTVMEKSLNGTKAVVSEA
PAPYNGNVVTGKEYDIKIEVNGSSIKCYIDGVLTNEFNDEILEKDVYTSSSVDSKTGDII
VKVVNTTATAKDVKINLNGVDNVKAQGTEEIVSSASQADVNSFASKTKVTSVKNNIYGLS
KNFTYTAKENSVAVLRIKKGTAEDSLKTGLKVYYNFDNKVGSSLTDLSGNSNNGTLGNSA
NLSNDSKFGQGLNLDGNGYVKLPNGLLDDLNDITIATWVKYSSGSADWERVFDFGSNSNN
FFFLSKNKHVGLNVNSTPQDLAPAGAQVNDTWIHVAVTLSNNTMIYYENGVEVARKTDVT
NKPSGLKAATENYIGKSKFSDPLLKAKMDEFRIYNRALSASEITQLNTLAPQNTVEVYST
TGVNKIDTVGDTLQMAATVTPSGESVDWAVVDLDGRTTDLASIDANGLLTSKKTGTVMVV
ATTKSDSSVYGFAKVVITQKVDSLTLSGAEGKASITTKGGTLQVMSKALPSNATDKTVTW
ALTDADGKITNVATIDENGVVKARKDGSVFAVATAKDGSAVTAKLDITITGQTIVENEKL
AAICPQEPNEPLLYDVENINNDAAWGTSNTHDPSIFKDGEWYYVFSTDYKVGGATGVGLQ
VRKSKDLINWQWVGRAFTEIPGAAKAWATGAENMWAPDVVKIGDTYYLYYTVSGFGTNNS
FIGVATSKSIEGPWTDQGEVYKTKKGIDTDNALDPNIVADANGDLWLAYGSFFSGIFVSK
IDKTTGKLVTPGKGTQISATGTRKNMEAPYIVYNPEFKKYYLFMSYDDLGVDYNVRVAWS
DKIDGPYTDLNGKSMMETPTDRDALYDIGTKLIGSYAFGNDPGWMAPGHNSVLNDNGNFY
LVHHARGGVDKNWAYLQVRKIVWSADGKPAVSPERYAGEQEQKIDQSLIAGKWQTIVQNR
LNNNKLTSTDITLYANGKINDENGQSFWKLTGDNTLTLNYYDPGKAPGDYWVDTVKVLPA
WDYENWKPTLVFTGYNQANTEVWGKQVGEINAKVTEIKVSTKENLLSISEKGGKLQMIAE
VNPSYADDSSVTWSVVGVDGNATDLVTIDETGVLTAVKDGSVKVVATANDGSGVVGTVEI
KISGQATVVNPDDKPVDTEKIIIKPVVDGVLQVIVNVIDNKDGNTVINLDNKAIDEITDI
TINDINSILTGTGNLIVNLENNMTIKLPYTLIDKSLLKNGAKIIFRTHVKKNSDLYKDLK
GINKVFSFEMVVVNGTEETVIHQFASGLAEVSINLTDEDLKGLDKNKLVVLYYNESTKKY
EEMETVVNGNKVTFKTPHFSEFIIAEKSVVQTPQTTDNTSGVPQTTEKTSVILPQTGSFV
DGNLLLLGGIIIYLFGLGVVLISRKKSIRG
Download sequence
Identical sequences D9SQP2
WP_013291775.1.47838 gi|302875379|ref|YP_003844012.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]