SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302875407|ref|YP_003844040.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302875407|ref|YP_003844040.1|
Domain Number 1 Region: 569-765,799-931
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.83e-36
Family beta-glycanases 0.0042
Further Details:      
 
Domain Number 2 Region: 10-238
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-20
Family Leech intramolecular trans-sialidase, N-terminal domain 0.069
Further Details:      
 
Weak hits

Sequence:  gi|302875407|ref|YP_003844040.1|
Domain Number - Region: 1160-1248
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.000111
Family Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 0.033
Further Details:      
 
Domain Number - Region: 463-537
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00181
Family CBM4/9 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302875407|ref|YP_003844040.1|
Sequence length 1250
Comment alpha-L-arabinofuranosidase [Clostridium cellulovorans 743B]
Sequence
MRHEENKVTYKDNIIAQYKFDDPTNIGKDTSGNGNDGVAKGSQLPLVSKIAGKDAITFPG
GSSGTSYLNLPSDLLKDISDDTGVTISTWVYFEKAINVWERVFDFGKGATGPYIFMTRNL
RGVCSAGEELAVDPVKSYGMGEWIHVAMTVIGTKGGTLSSAGPIIYINGELVADGSISQT
SSGAYAKLRHWFKTFEDKENYSDNNIGKSKFDVDPDFCGSVSDFRVYKAGLTEDEVIEVL
CESLTDEDIIKLAKDKYLSLETNIITKDIILPSSLMGGKVSVAWKSSDLEVISNTGEVKE
IKTPKGVTLTAVLTKGSYVEEKSFSISVLPKDLPPYTLTIEGNNEVVDISKTLYGLFYED
INNAADGGIYAEYIQNRSFESFVFDTYSQASGENGVSTGRVRKPLHAWSGDLDKVIVRNQ
GGLNEFLSLEDKEINSTYITVSDGATIYNRGFADNNKNCSMLIKKGDKYNFTIWAKAGSE
GTITLQLLNKDNESVSDVATVEVEGNNTWKKYGIDTKIFLTGTDSVLGQIALTFKGEISI
DMVSLVPENVWGATEEETSKTAHVNYLGNPNYRLRKDLVQTLMDLHPTFLRFPGGCISEG
SYIWENVYDWKESVGDVEVRKENFNVWGYVMTMGLGYMEYFQLAEDLNATPLPVMACGVL
CQARSDYANPAGGKLRDKYIKNFTDLIDFAISIDFENNQWAALRKKMGHEQPFDLHYLGV
GNENWGTEFFANFEIFKVAIDEYMEKNYPGYELYIISTVGAQADDDAYQEGWKFLSGNLT
GTAKVSFTDGKTSKEETVSWYNNQKDYMETIADEHYYRSNEYLLNNADRYNYYYRSYNAD
GSLNDAETSKVFVGEYASTDKNTLAGAVAEAAIMTGFENNSDVVRLAATAPLFNKVLTDG
SYRWTPDCIWFDDETVWRTPNYYVQQLFAKYLGTKVLGTSFSTYKNGEALDLIPRGGIEI
ATGDAEILVRSIKVVSNIDGNVIFEQDFTKELSSAWSVIPGSVGYNIDNEKGLVLKPQKS
GLNGLYIINDAWTNYKVEVVATKISGIEGFYVGAGLTEINQDKKDVIEYAIAYNGNSTGV
KVYKKGIEAYRLGDYSSSSAAGNLRTSCFEELLNNKEYAITVNYGGTSGKNLICSYTDGE
SKSKVLDYKLEAYNRDIFNSVTRDEKHVYVKLVNADNIEKVIKLNFKDLSVNEIGKMIIL
TGDSSIVHVPNVNRKNEEYVTPKEYEVKLTDKSAVLTLPANSVNVLVFEL
Download sequence
Identical sequences A0A173N090 D9SQS0
WP_010075535.1.47838 gi|302875407|ref|YP_003844040.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]