SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302875419|ref|YP_003844052.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302875419|ref|YP_003844052.1|
Domain Number 1 Region: 40-78,105-519
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 5.35e-120
Family Cellulases catalytic domain 0.000000051
Further Details:      
 
Domain Number 2 Region: 555-703
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 7.85e-25
Family Cellulose-binding domain family III 0.00047
Further Details:      
 
Domain Number 3 Region: 714-775
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000000889
Family Type I dockerin domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302875419|ref|YP_003844052.1|
Sequence length 777
Comment glycoside hydrolase family protein [Clostridium cellulovorans 743B]
Sequence
MKKYGFFSKKTKSSIISAIVSSVLLSSVSTINTKAADLEFNYAKALQYSQFFYDANMCGT
GVNENGLYNWRGDCHTYDAKLPLDSKNTNMSDSFILANKTILDPDGDGTVDVSGGFHDAG
DHVKFGMPEAYSGSTLGWGFYEFRKQYEATGQDAHAKTLLRYFNDYFMKCTFLDSSGKAI
AFCYQVGDGDIDHAYWNAPEIDEMFRRGWFATDELPSTDVLAATAASLAINYMNFKDEDP
AYAEKSLKYAKALFQFAERSDTKKCNADGPKGYYGSSKWQDDYCWAGSWLYLATQDEHYL
NEVFKYYDYYAASCWTHCWNDVWAGTTCVLSEIDDLYDKDGQVLENKFRTAANKSPYEEI
NFWSQIAKTVDNWMTGKTVTITPGGYSFLNQWGSARYNTSAQLLALVYDKHHGNTASKYS
EWAKSQMQYLMGENPANRCYIVGYNDIAAKFPHHRAASGLSKCEDPASHRYVLYGALVGG
PGSSDEHKDVTSDYIYNEVTIDYNAAFVGACAGLYNFFGDSSMTVTPNFPPKASTGDDPS
TGGTSYWVNAFGVDIAQADGPKATEVTLFVGSDTRTPSKNISVRYYFDATGMSSLAADKI
EMRQLYDQAAAETTYKATLSGPKQYKDNIYYIEISWPGYAIANSNKKYQFALGTYAYQNY
WNPTDDWSHQGLSIESSNWTGTPVKTDHICVYDNGVLVGGTEPDGTTPSKPVTPTIIKGD
INNDGKINALDLAFLKMHILGTKTLTDNALIAADYDSNNAINAIDLIKIKKYILGQA
Download sequence
Identical sequences A0A173MZP3 D9SQT2
WP_010075548.1.47838 gi|302875419|ref|YP_003844052.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]