SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302875445|ref|YP_003844078.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302875445|ref|YP_003844078.1|
Domain Number 1 Region: 178-500
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.44e-57
Family beta-glycanases 0.00045
Further Details:      
 
Domain Number 2 Region: 600-656
Classification Level Classification E-value
Superfamily Type I dockerin domain 1.57e-16
Family Type I dockerin domain 0.00056
Further Details:      
 
Domain Number 3 Region: 35-157
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000697
Family Family 6 carbohydrate binding module, CBM6 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302875445|ref|YP_003844078.1|
Sequence length 657
Comment Dockerin type 1 [Clostridium cellulovorans 743B]
Sequence
MKKIFGRAMSLLATFALVCSFFVAMPTTPVKAETSLPVKVEAEACTLSNGAAVTTNVYGT
NYPGYSGNGFVWASNSGTITFNVTVPKNGMYEISSRCWMYLGNVGDTRLQVLSINGAAQG
NFYVPNKGGWADYSFGYFYLEAGTAKIEIGSSGSWGFILYDTVTFDNAKMPALKADPTPC
DVNATSETKNLKQYLTSVYGNHVISGQQEIYGGGNDGNAELEFDYIYNKTGKYPAIRGFD
FMNYNPLYGWEDGTTNRMIKWVKERGGIATASWHINVPSDFTNYKLGDKLDWKSCTYKPT
ASFKTANCLDKTSKEYAYLMLAVDDLAKQLLILQDAKVPVLLRPFHEAEGNNNTNGSGAW
FWWGSGGADVYKQLWKLLYSTLTEKYGIHNVIWEVNLYSYANSAQWYPGDDCVDIVGYDK
YEGSPYTWKTSAATSVFLTLVNHTNDTKMVALTENDVIPDIQNIVNQGAWWLYFCPWYGD
FITSSTYNDPVLLKTTYNSPYVVTLDELPKDLYASSSKVQAPTLSVKEGTYSVTQTVALS
SATEGATIYYTLDGTEPTVASTVYDKPIEVAKTTTIKAIAIKAGLTNSDVVTATYTISVS
MLGDVNNDGKVNAIDYAMVKSYLLGNPVTINLKNADLNSDGKINAIDLASIKKILLS
Download sequence
Identical sequences A0A173MZP6 D9SQV8
WP_010075583.1.47838 gi|302875445|ref|YP_003844078.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]