SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302875449|ref|YP_003844082.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302875449|ref|YP_003844082.1|
Domain Number 1 Region: 170-366
Classification Level Classification E-value
Superfamily Kelch motif 6.15e-62
Family Kelch motif 0.0000582
Further Details:      
 
Domain Number 2 Region: 41-166
Classification Level Classification E-value
Superfamily Kelch motif 1.96e-46
Family Kelch motif 0.00041
Further Details:      
 
Domain Number 3 Region: 359-440
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 8.24e-17
Family Invasin/intimin cell-adhesion fragments 0.0038
Further Details:      
 
Domain Number 4 Region: 446-519
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.000000000000224
Family Invasin/intimin cell-adhesion fragments 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302875449|ref|YP_003844082.1|
Sequence length 601
Comment Kelch repeat type 1-containing protein [Clostridium cellulovorans 743B]
Sequence
MENKINLKIKTSIIFIICTLIFLFGSVKFFNVKAAETLDVSDKWITIASMNEAKYYSNSV
VLNGKIYVIGGYNRKQPFSSMEVYDPATDTWTKMASMNEARHHHISVVVNNKIYVIGGSN
GIKSLESAEVYDPETNTWTMLPTMNQARYESNLAVVDGKIYVIGGSGTNGSVEVYDPTRN
TWKVVASMKEARDSFTSAVLNGKIYIMGGYKGGGLLSSSIEVYDPAVNNWTTVTSMNGGR
AFHNSVVMNGKIYVIGGADLKGYLSSVEVYDPVINTWTTLASMNIARLDFTSVTVNNRIY
AMGGAGIPSSVEVYDVVSNTWMKLADMNTERIGHNSVALNNKLFAIGGYNGGSILSSVEV
YSISKMVIEKNYDSLKVGQTDIITAKTTPAGIAITWTSSDPSIATVDSNGKVTAVKPGTV
SITARAVDGSNLSATCQITVKPETIINLSKTSMSIIIGQTDTLSATVTPSDILVNWSSND
SNIAAVDSSGVITAIGTGTTTITATTSDGKTANCEVVVTPEKTIEYRGKLTLVMPYNDLK
IYDLSKDEVDSFLTWYEGRSNGVGKSYYIFQNKSKNSIIISKDYIPYNKISYFNIEEYEV
S
Download sequence
Identical sequences D9SQW2
WP_010075590.1.47838 gi|302875449|ref|YP_003844082.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]