SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302875476|ref|YP_003844109.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302875476|ref|YP_003844109.1|
Domain Number 1 Region: 1206-1545
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.62e-44
Family Pectate transeliminase 0.0000279
Further Details:      
 
Domain Number 2 Region: 508-583,610-642,680-836
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.23e-37
Family Pectin methylesterase 0.00024
Further Details:      
 
Weak hits

Sequence:  gi|302875476|ref|YP_003844109.1|
Domain Number - Region: 413-517
Classification Level Classification E-value
Superfamily EreA/ChaN-like 0.0785
Family PMT domain-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302875476|ref|YP_003844109.1|
Sequence length 1899
Comment pectinesterase [Clostridium cellulovorans 743B]
Sequence
MKVYILIGGVKMQKKSKRIISNILILVLLFTTSFNNITIFAADMANDRKIDVWDFGGVQT
SGDLYNNVISTSTLDNLTTITAGKFAGGKTTFGDLSIIPNITDRSYYNNSEGTPGKNSYG
TWGNAAKIYNDGYTSAGGYYCNGTTGGFSGANRFLTIDNVVAGDKLSVYGGTSNGNEKIH
LLYLGTDGTQDTAVDFTITASRADLVAKYSGSYRIYVSSAAGGKPYFHRVVRTPGVKISG
KVNLNANSTSADFTFVNQTTGDATDIKVKADNTFDTVLAADYKYTAVLKGDISYKISKES
KVVEILTSDILTGKSNVNLDVVANHVATIAGSFKGFDNSYNVSKLQMKLVPDKESLSSEV
TATVDTTAKTFTAIVEQGVQYTAVISGINDYEIIDGASVNISTNTTKDITVAKKAVYTAT
GNFLNLSETAKIQSISFTNVEDGYNYTGNVVGGGYSVSLRNGAYTVNPECTEKYQTSTHV
VVNGQNTTKDIKFNQVIDGVQELPRVPDLYVGDSSKDNNFSTVKEALDAAAKMNPTSEAE
RITIHIAPGTYRAQLKISTPYITLVNSNPSQEVKLTWYYGFGYEYYSVGADGFYNEDRSF
DKYSKRHVSDGKWGGSVYLTSAAKEFKAENIVFENSFNKYITKEELADGVVLCKTFPQST
SINVERTANLDVTSKAATERAAAMIIDADNVEFNNCSFIGSQDTLYTGISGANNQYFKDC
FIEGNTDYIFGDGNVVFDNCKLNFCGYSDQASAGYITAAKDTATYGYLFRNSTVTAKSKN
KQTAGFFGRPWGPKARVKFANTKLESSSIIDPKGWTDMSGATPENADFAEFNTTYNDVKV
DTTARRSPVLSDETSIASIENYFGGWIPKYYTGKIGPVKEVFEWKSIEFGASTSSDNNTV
VVDDTNKTVTVTAGLKDGTKTGGKITGSQDGISYYYTEIDPSKNFEISADVKVNYFAKPN
PDGQEGFGLMARDSIGKNGDASVFASNMVMVGGYGGSKNVALIQSVFRNNVKDSSGMGAV
MEDITKFGDRPANDGTATYKLTMKKTNTGYHVSVNNGKEKIYYRPKQLEVLDKDKIYVGL
FAARVASITVSNIDMKTSNVETDPVGVPEPPRPTLPAVSATSLDATSSTSYALKATPNVK
GNLQVKLAGTEIYNKEVEGNKEFVLNTTLVNGENTFDITFTPASTEFVSSFDPINIKKLV
TVKNYGVPGGAIYVSPSGTANAAGTEKDPIDIYSATKFISEGQTIYVRGGTYNLTVPLII
ARGNNGIADKLKVLSAYPNERPVFDFGTKSQGFNLDGDYWNVYGIDVTKAASAGFRISGN
NNVAELVNTYENGDTGFQISGSAAESKDKWPANNLALNCTSYDNRDASENNADGFAAKIT
VGAGNVFRGCIAHNNTDDGWDLYSKSESGPIEPVVVENCVAYGNGALTNGTMTKGDGNGF
KLGGEGLAVKHILRNSLAFKNKSNGVTNNSDPAVIIENVTSVDNGKSNFEFHYYSNPKPT
ITTSAKNSISFRTSSGISDDMPNLASEDNYFYFSNDDASKNISGKQLLASDFKSVTAPTE
VTRAADGSIILGDYMVLASKTVSIASIISPAAVKVTKGNTVILPQTVTAVYSDETQKEVA
VEWGNVDTSTVGTKIVEGIVEGYARMVTITVNVEAAVEEASNLKPGKLEDKIIDNNIRPE
ALKEIVINAKPEDKIIINAQEKQVASAEVFKALQGIDKEVSFRLQSQGKTIIWTFNGKDI
KDVNTSVDLSLNLEILNKDAINSIASDAEIISFKNHGVLPASMKVSISVDTNKFDIIKPI
YVYYYNETTKKAELVGDGLKAYKIGEVYFVDVILTHNSDYFMTGTKVVEAEIKQDTEAKS
EKVETLVQTGSFLDLNVLVLSGIIIMGIGFVMLRKKKEN
Download sequence
Identical sequences D9SRB6
gi|302875476|ref|YP_003844109.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]