SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302875543|ref|YP_003844176.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302875543|ref|YP_003844176.1|
Domain Number 1 Region: 304-566,623-886
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 8.16e-45
Family Glycosyltransferase family 36 C-terminal domain 0.008
Further Details:      
 
Weak hits

Sequence:  gi|302875543|ref|YP_003844176.1|
Domain Number - Region: 120-296
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.000132
Family Glycosyltransferase family 36 N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302875543|ref|YP_003844176.1|
Sequence length 913
Comment cellobiose phosphorylase [Clostridium cellulovorans 743B]
Sequence
MNEKYKIPSWSFKGNKGEFILEDPHKTSGLYFPLANEAGMMSSITPLLAGDIKTSQNTFL
MQPVSSRDLHNSLDSRNFWLNIDEKFIWSATGNSAYQKLMGFKTESEEKVELEAGYLWHK
VTRENKVLGVSSEIINFVPVNQDKVELMKVTIKNIGDKKIKFTPTAAVPIYGRSADNIRD
HRHVTSLLHRISTNEYGVVINPTLTFDERGHKVNNIVYSVQAVQGDGTSPIGFCPVEEDF
VGEGGSLDWPEAIVNNKISFCGKYKTIDGFEAIGAIRFQDCSLEPRESNSYIVIMGINDS
GLPIEEYVSSYGELLKFEDELEKNKLYWETKLSSLSFKSSSRDFDMWMKWVEVQPIMRRM
YGCSFLPHHDYGRGGRGWRDLWQDCLALLLLEPKQVRELLYNNYGGVRFDGSNATIIGSK
PGEFIADRNNISRTWMDHGAWPYLTTKLYIDRSGDLEFLLEKQAYFKDKQCRRSREVDTK
WTDEYGRKQKNNDGSIYMGSIIEHMLLQQITAFFNVGENNNIRLEGADWNDGLDMAVEKG
ESVTFTAFYGSNLMDLSKLLKSIKEKLKIEEIEIALEMTTLFDTLRGRIDYDSVTEKNNL
LNSYFDLCIHNVTGEKAMISIDELSSDLERKANWIKEHIRKNEWVKTSDGFEWFNGYYDN
DGKPLEGQFKSGIRMTLTGQVFPIMGDIADEEQIEKVILSINKYLKDQKVGGIRLNSNFN
EVKLNMGRCFGFAYGHKENGAMFSHMTIMYINALYKRGYVKEGYEILSMIYKHCSDFEKS
RILPGIPEYINERGRGMYNYLTGAASWLLLTMVNEVYGIKGSLGDLKIQPKLLMEQFDNN
YLASIFTTFRDKKINIVFINERKLEYGSYRIGRATLDGKTIELNLIEDSLVIDKTYIDKL
HIDDKHELIINLV
Download sequence
Identical sequences A0A173MZS1 D9SRI3
WP_010076602.1.47838 gi|302875543|ref|YP_003844176.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]