SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302875545|ref|YP_003844178.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302875545|ref|YP_003844178.1|
Domain Number 1 Region: 432-635,669-987
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 1.98e-52
Family Glycosyltransferase family 36 C-terminal domain 0.00035
Further Details:      
 
Domain Number 2 Region: 203-413
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.000000471
Family Glycosyltransferase family 36 N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302875545|ref|YP_003844178.1|
Sequence length 990
Comment glycosyltransferase [Clostridium cellulovorans 743B]
Sequence
MKEIVARKVQQSAEQKLREIFNEKIQKESIIDGIYYDSTYENAVGVANLPIKIPVTLALF
KDREIAELLDNNLEESEFVLISLTEGLDNVNIIASSNGKITEKQLATDISFKINRIVQKI
TYGVGFLNEEGEHEIDLLAPTPGPHFYTNLLLGNRVGFPHPLQTTPKSVVDKLGRGSFRS
HAATQVLATRWDMLQEENGFPANRQFYLVEDGKQIFYSANVSDENIEKGKCIHSQNHTKI
LYKTHCGLTIERTIFLLQQEEDMPIAVEVQQIRIINNSDKSRKLKIVYTGMFGSAVPSAL
MEDVLYSNVIMQSKVLNDKDGSILAILPDYYPMYTKGDYRFHTMISHTKEELFLAKEFCT
SYSEFVGNGSLEKPEGVFKLSNKLNRKGPGFFAVSSQLTINPKDKVVVDNFTGLVSEKTN
DNFTEDEIKVQIENLVSKYKDETEIEKAINRNREFLNSYRGYLQVNSEDKQFDTYVNKNL
PFQVLYQTFVSRSFDQTQKGYREIGFREIQDIYASMYYFIGMGQQQLVKNLIKEWVEKVF
EFGYTYHNFFWVGKEPGKWSDDGLWLIPAIYRYISITGETSILDEQCEVAGCNEAKTRSV
YETLKAILRYSGEISIGKHGMPLLDFADWNDCLKLDTNYINGIEKERRYKEQIACTGKDG
EPFESDYSESVMNAFLLKSAMDEMLVFAKEREDFKYYDKLETLSEKLYKNIQNHGWKEDF
FARVLFNRYENGEYTYLGAKGDKLSADSNKDGTYFLNSFNWSILSDCATEEQIEKMLDSI
ELHLKTSYGIKLISPADLEKVARNTATGEYFPGDRENGGIFKHATMMATSAMFKAAKKVD
DIELAKRLTNTAYWMIDLVVPYKTMEKPFETCGNPRFCTQYNNSETGENIGPTLSGTSTW
LTLSLFDAFGIEYTSKGIEINPILKEEQKNLELFINTGKAKYKIKISKNLGFYRLKDSKY
SIKVDDVFIDDNIIENFEDGKEHTVEIQFI
Download sequence
Identical sequences A0A173MZQ7 D9SRI5
gi|302875545|ref|YP_003844178.1| WP_010076604.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]