SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302875569|ref|YP_003844202.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302875569|ref|YP_003844202.1|
Domain Number 1 Region: 32-481
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 1.02e-157
Family Cellulases catalytic domain 0.00000000000943
Further Details:      
 
Domain Number 2 Region: 489-644
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 4.6e-36
Family Cellulose-binding domain family III 0.0000176
Further Details:      
 
Domain Number 3 Region: 651-715
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000000157
Family Type I dockerin domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302875569|ref|YP_003844202.1|
Sequence length 716
Comment glycoside hydrolase family protein [Clostridium cellulovorans 743B]
Sequence
MKKLGSILASVVMLASITAPLKAPVKVSATENYNYGEALQKGIMFYEFQRSGDLPENGRN
NWRGDSGLTDGKDNGLDLTGGWYDAGDHVKFNLPMAYTVSMLSWSVYESRGAYEKSGQLP
YILDNIKWATDYLIKCHPSPNEYYYQVGDAAADHSWWGSAEVMPMARPSFKVDTANPGSA
VVGQTAAALAAASIIFKDTDPSYSELCLKHAKELFTFADTTRSDAGYKAAQGCYSSWSGF
YDELTWAATWLNMATGDSAYLDKAESYVPNWGVELGTSTPKYTWAHNWDNCIFGSYLLLA
RLTNKPLYKECAERNLDWWSTGVGTQRVPYSAKGLAVLDMWGSLRYATTQAFLASVYADW
SGCDVTKATAYENFAKSQIDYALGSTGRSFVVGFGENSPTHPHHRTAHSTWMGYLTCNIP
DYSRHTLYGALVGGPDTSDKYTDDINNYQNNEVACDYNAGFVGILAKMYDKYGGTPIENF
KAIETPVDEYLAYGSSSGTSGNELQLMVSIRNQTGWPARGSDKLSARYFMDITEEIKAGI
KPSDFTAKASTSGVKLSGLIPWDVDKNIYYINIDFTGTNISPINNNTYKKDVYMSIGIPY
GTAINCANDFSFQGLTATTGGQDGVKTKYIPIYDNGVKVAGEEPTLIVNPTIKKGDVNND
TKISAMDLALLKKHIMGTSTLTGDAFTAADVDSNGKVNSIDLALLKKYILGQITSF
Download sequence
Identical sequences A0A173MZM9 D9SRK9
gi|302875569|ref|YP_003844202.1| WP_010076628.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]