SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302875643|ref|YP_003844276.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302875643|ref|YP_003844276.1|
Domain Number 1 Region: 43-195
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.29e-33
Family CBM4/9 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302875643|ref|YP_003844276.1|
Sequence length 201
Comment Carbohydrate-binding CenC domain-containing protein [Clostridium cellulovorans 743B]
Sequence
MNKKKIMAYATAFVTLLSVPTVVTSVVATESVSAFTRINLGELIRNNTFDYNVATPWQLT
KISPAEASIEVKDGKCYVTILKNGEDGRWDIQLRHRGIVLDQGHKYRVRFTVTADKDCYI
YPKIADQGGSFNEYWNYNTYQKIQLNAGVPTTIDQIFQMNNATTRSAEFVFDLAGDCQAA
TFPYKLTFDDIYLTDLNHIQY
Download sequence
Identical sequences D9SS65 Q9LAJ1
WP_010074609.1.47838 gi|302875643|ref|YP_003844276.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]