SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302875645|ref|YP_003844278.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302875645|ref|YP_003844278.1|
Domain Number 1 Region: 102-408
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.35e-62
Family beta-glycanases 0.00011
Further Details:      
 
Domain Number 2 Region: 27-94
Classification Level Classification E-value
Superfamily Type I dockerin domain 1.57e-17
Family Type I dockerin domain 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302875645|ref|YP_003844278.1|
Sequence length 425
Comment Dockerin type 1 [Clostridium cellulovorans 743B]
Sequence
MKRRILSILTAALVTATIIPFSASAATTLGDVNVDGKVNSIDMAIVKQYILGTKTFSDAE
LKAADVDANGKVNAIDLALYKQYILGSITKFPGDKGVVDNRTTTGPGITWMDGYKLFPVG
VNYGWNNWCYEFSDSNWDTNFAKMKSDMDAMNLKGVKSLRWWVFPDLAFGPTWSGTGKGS
LCTGLPNNWVNHMKAVCDYALTKNIKIYWTLTSFDAARQDGTDHHSDIFTNEAVRQSFFD
NAVKPIVTALGNHEAVMGWDCINEPEWIIKKEDNGEPKASGYDIYALSDIRNYVQSTTAL
IHQYAKQPVSVGSASMKWSGAQFSLWTGLGLDFYDFHWYDWATPWFNPMTTPASSLKLDK
PVIIGEMMSDTLSSSLKVDHKVVMDAIMANGYSGYMTWAWNDGSCGNFIGSNFTNFGAQH
TDIVR
Download sequence
Identical sequences D9SS67 Q9LAJ3
WP_010074612.1.47838 gi|302875645|ref|YP_003844278.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]