SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302875646|ref|YP_003844279.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302875646|ref|YP_003844279.1|
Domain Number 1 Region: 28-453
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 4.54e-151
Family Cellulases catalytic domain 0.000000000611
Further Details:      
 
Domain Number 2 Region: 464-522
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000000981
Family Type I dockerin domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302875646|ref|YP_003844279.1|
Sequence length 522
Comment glycoside hydrolase family protein [Clostridium cellulovorans 743B]
Sequence
MKKIIATATSLCLSAGIILPATEAAAAPKFDYSDAFGKSIMFYEANWSGKVENNRFDWRG
DAFLKDGADVGLDLSGGFFDAGDHVKFGLPQAYAASTLGWGYFAFKDAYKSNGQDAYMLK
ILKHFTDYFLKCYPDNNTFYYQVGDGDLDHAYWGPPEIQPTARPTKFKATPSDPASDVCG
NTAAALAIMYLNYKDVDATYANKCLTAAKNLYSLGKNYKGLSHGQSYYVSTSYYDDLAWG
AVWLYQATNDNSYMTDANSFLSQINADGDKVYTSYWTHCWDNVWTGVIYKMAEVTGKANY
KASVENNLNYWMNNIKTTAGGLKFATDWGSLRYSSTQAMLALIQYNRTKEQKYLDFATRQ
IDYILGDNPRSSSYVVGFGNNYPKFPHHRGASGRLEPGEMKTMPEKHILTGALVGGPDGN
DQYKDDINNYQQTEVAIDYSAGFVGAMAGITKYLDPAPIIIDPITYALGDVNKDGKVNAI
DLAILKKNLLNGITGDLTVSDMNKDGKVNAIDLALLKKLLLG
Download sequence
Identical sequences D9SS68 Q9RGE6
WP_010074613.1.47838 gi|302875646|ref|YP_003844279.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]