SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302875648|ref|YP_003844281.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302875648|ref|YP_003844281.1|
Domain Number 1 Region: 310-819
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 5.35e-135
Family Cellulases catalytic domain 0.00000000019
Further Details:      
 
Domain Number 2 Region: 43-195
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.98e-32
Family CBM4/9 0.0047
Further Details:      
 
Domain Number 3 Region: 208-307
Classification Level Classification E-value
Superfamily E set domains 4.06e-26
Family E-set domains of sugar-utilizing enzymes 0.00049
Further Details:      
 
Domain Number 4 Region: 834-891
Classification Level Classification E-value
Superfamily Type I dockerin domain 8.63e-16
Family Type I dockerin domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302875648|ref|YP_003844281.1|
Sequence length 892
Comment glycoside hydrolase family protein [Clostridium cellulovorans 743B]
Sequence
MRSKKLIACVTALATVLSVSTVATSVATTKTVSAATMVSVGELIRNNKFDNGVGLPWTVV
ESYPAKSSFEIKDGKYYVTVLQDGVEGRWDVQFRHRGLVIEQGHKYRVKFTVTADKDCYV
YPKIGDQGEPYKEYWNYNSYQRVQLRAGVPTTIDQTFEMRDATARTAEFAIHLAGDCKAA
TFPYTFTFDDMYVSDPQFPGYVAETPEPTNAIRVNQVGYLPGVAKKATVVTKATTPINWY
LKNSSGVQVATGTTTVKGLDSASGDNVHIIDFSNYTTPGTGYTLSVDSTNVDSTINDSAS
SMPFTIGTDLYSKMKHESIKYFYLNRSAIPITMPYAERTDLTRAAGHTTDLMPTDASSSD
PSPWYKENYSLDVTGGWYDAGDHGKYVVNGGISVWTMMNQYERAKKLGQANVAPFADNTM
NIPESGNGYPDILDESRFQMDLMMKMQIPAGKTYAGMAHHKGHDERWTALAIRPDQDPMK
RYLKAPSTAATLNLAATAAQASRLWKGIDDAYSAKCLASAETAWKAAKANPAIYAPFENG
PGGGAYGDDNVTDEFYWAAAELYETTGTSEYLDYMKNNSSDKFLKMPTTLTGGEDKGLSG
AFDWGNVAGLGTISLAIGDKLDATSKATVRANVAAAADVFVANTNSEGYGTPMVQGPAFE
EKDASGKVIRTITGYPWGSNSFVANQAIVMGYAYDFTKGDADKKKSNSYFNGLTSAMDYL
LGRNPMVQSYVTGYGSNPLENPHHRFWAYQADNTFPKAPAGCLSGGPNTGLQDPWVKGSG
WGVGTKPAAKCFMDNIESWSTNEITINWNAPIAWMSSYMDLNKDAKTIDITIPPTTSGDV
NGDTKINAIDLAMLKKYILDNSTVIKTANADMNNDGKINAIDLALLKKKLLS
Download sequence
Identical sequences D9SS70
gi|302875648|ref|YP_003844281.1| WP_010074615.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]