SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302875649|ref|YP_003844282.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302875649|ref|YP_003844282.1|
Domain Number 1 Region: 39-487
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 1.74e-158
Family Cellulases catalytic domain 0.00000000000379
Further Details:      
 
Domain Number 2 Region: 493-650
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 9.94e-53
Family Cellulose-binding domain family III 0.00000199
Further Details:      
 
Domain Number 3 Region: 656-714
Classification Level Classification E-value
Superfamily Type I dockerin domain 1.67e-16
Family Type I dockerin domain 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302875649|ref|YP_003844282.1|
Sequence length 715
Comment glycoside hydrolase family protein [Clostridium cellulovorans 743B]
Sequence
MFNISKKKAQALLLSGILGATSFTPAVLVKGETTATPTFNYGEALQKSIMFYEFQRSGKL
PTDIRSNWRGDSGTKDGSDVGVDLTGGWYDAGDHVKFNLPMSYTVAMLAWSLSEDKAAYE
KSGQLDYLVKEIKWATDYLMKCHTAPNEYYYQVGDGGADHKWWGPAEVMQMARPAYKVDL
QKPGSSVVAETAAALASTAFALKDIDKAYSEQCIQHAKELYNFADTTKSDAGYTAANTYY
NSWSGYYDELSWAAAWLYMATNDASYLEKAESYVPFWKVEQQTTTIAYRWAHCWDDVHFG
AQLLLARLTGKSIYKESVERNLDYWTTGYDGNKIKYTPKGLAWMDSWGSLRYATTTAFLA
DVYASSDVCSISKVDTYKNFAKSQADYALGSTGRSFVVGFGENAPKKPHHRTAHSSWSDQ
QVNPTDHRHVLYGALVGGPDASDGYTDAIDNFTNNEVACDYNAGFVGLLARQYSKYGGDP
IPDFKAIEKPTNDEFFVEAGVNCTGPNFVEIKALVNNRTGWPARMGDKLSFKYFINVSEF
VNAGYSADDLKVTVGYNTGGTVSNLIPWDKENNIYYVNVDFTGVKIYPGGQSDYKKEIQF
RISGIQNVNIWDNSDDFSYEGITKTPGETPVKVTNIPVYDNGVKVFGNEPGTTKPPVIAG
DVNNNGIVNSMDLAMLKKYILGYEVEMNKEASDLNKDGKINAIDFALLKKLLLSQ
Download sequence
Identical sequences D9SS71 O65987
WP_010074616.1.47838 gi|302875649|ref|YP_003844282.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]