SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302875806|ref|YP_003844439.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302875806|ref|YP_003844439.1|
Domain Number 1 Region: 716-872
Classification Level Classification E-value
Superfamily Fibronectin type III 7.63e-20
Family Fibronectin type III 0.0024
Further Details:      
 
Domain Number 2 Region: 466-607
Classification Level Classification E-value
Superfamily Fibronectin type III 2.13e-17
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 3 Region: 68-297
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000000217
Family Pectin methylesterase 0.053
Further Details:      
 
Domain Number 4 Region: 889-968
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000619
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 5 Region: 612-708
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000126
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 6 Region: 293-471
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000174
Family Galacturonase 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302875806|ref|YP_003844439.1|
Sequence length 1093
Comment fibronectin type III domain-containing protein [Clostridium cellulovorans 743B]
Sequence
MKRKERISIIISLLFFASICFSSEIKVDIGESYAIRKGDEKITLGGRVRAYTLDSSWTTI
DQSSLGGMSLNTILNNLISSGKTKFYINDGTYYLDGEIKIEKDNIILQGQSQINTKIIQN
NIASNVIEITAGGTQILDLNIDNSLGKVAVYSINSNNTSLRNCIINGSDNNPAVAFYGNN
TVDDITAVESGNLNFNNVIENNMINSPLNGSNKDGVIFVKQKNGLVKGNTLSGSRIAFYL
SRDSEVSYNTIKNSSTNGIRYTVPAYDNKIINNIIQDVKASGIVVDRNDKGITPSDYRAT
NLTISNNNISGSRYFGIEISNLMSSTIDNNIIENIDFNGVYLLYSDSLFISQNKIYETGL
CLVNGMLWAWDKNLNSGILLDYMVTNSIMDSNEIINSINSCPHGIKVQSNDSNINNSITY
NNISGYFINGVVAKDTSPENTYIFGNVINLSLLPVLENIKWTSTIGTVTLTWDPQIGAIG
YEIEKDGNIIDNGNSTSYTVTGLASSTNYNFKVRVKLGIWSDEITAITMTPVLKNIKAET
TEDSVALTWDPEISATGYEIEADGKIIDNGNNTSYKITGLKSDTNYSYKVRAKNGLWSDE
ITAKTLSSVVPPPDPVILPVLKNIKANTTENSVTLTWDEEIGAIGYEVGVDGKILDIGNN
TTYTITGLKSATNYNYKVRAKNGIWSDTIIAKTLSPVIPPPPDPVILPVLKNIKAITTEN
SVTLTWDEEIGATGYEIEIDGKILDNGNNTSYKVTVLKPATNYNYKVRAKNGTWSDVITA
TTLSPAIPPPNPVILPVLKNIKATTTENSVTLTWDGEVGATGYEIEVEGKIIDNGNSTSY
TVTGLKSATNYSYKVRAKNGTWSDVITATTLKPVIPPPDPIILPVLKNIKATTTENSVTL
TWDEEIGATGYEIYINGKILDNGNNTSYTVTGLKSATSYSYKVRAKNGTWSDVITATTLS
SVILPPDPVVPPDDSKKPSVKVPVVSVIPQAIAPISPVGKNNLVASSATTVSNKTDNRVD
NKDINKGNSEADSDKDTDGLSSSTKSDEATNRKSDPEKQDISHNNKLLIFISAILGLSAI
AVFARIRLFRKKI
Download sequence
Identical sequences D9ST13
gi|302875806|ref|YP_003844439.1| WP_010075772.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]