SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302875896|ref|YP_003844529.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302875896|ref|YP_003844529.1|
Domain Number 1 Region: 22-427
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 2.58e-42
Family Cellulases catalytic domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302875896|ref|YP_003844529.1|
Sequence length 648
Comment hypothetical protein Clocel_3075 [Clostridium cellulovorans 743B]
Sequence
MDKFLTSEVLPIKSVEIKDDFWGKYIDLVNEVVIPYQWEALNDRLPDAEPSYAIKNFRIA
AGLEEGEFGGMVFQDSDLYKWLEAVAYSLETNPNPELMAIADEAIDLIEAAQGDDGYVNT
YFTIKEPDKRWYNLCECHELYCLGHMIEAAVAYYNATGKRKFLDIACRFVDYVDTIFGPE
PHKAKGYPGHQVIEMALVKLYDVTNNSKYLALSKYFIDQRGQEPNYFKEEYEKRDGVSHF
LKTKIPLDLPYNQAHKPVREQEVAVGHAVRAVYMYSGMADIAAKTNDETLKKACETIFNN
IKDKQMYITGGVGSTAHGEAFTYDYDLPNDTVYSETCAAIGLIFFAQRMLKLDQDRKYAD
VLERALYNTVTSGMALDGRHFFYVNPLEVQPEASEKSPIKRHVKAERQKWYGCACCPPNV
ARLLTSLGQYIYTESNDTIFTHLYIGSKADFTVNNKKVTVKQTTNYPSEGKATFVFDMSE
NNEFTFALRIPEWCKNYKIFINNEEYRELDLNKGYLYITREFLNSDVVEISMEIETVLVA
SNPLVRANAGKVAICRGPLVYCLEEIDNCKNLSSILIDTSKPVKEQYNPEVLGGAIELKA
SGYIVSSESQDLYTSFNVKEMPFNITAIPYFMWGNRGLGEMSVWIRYK
Download sequence
Identical sequences D9STN1
WP_010075861.1.47838 gi|302875896|ref|YP_003844529.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]