SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302875898|ref|YP_003844531.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302875898|ref|YP_003844531.1|
Domain Number 1 Region: 440-520
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 2.12e-16
Family Invasin/intimin cell-adhesion fragments 0.008
Further Details:      
 
Domain Number 2 Region: 115-188
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 0.0000458
Family STM3548-like 0.078
Further Details:      
 
Weak hits

Sequence:  gi|302875898|ref|YP_003844531.1|
Domain Number - Region: 553-669
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00285
Family Leech intramolecular trans-sialidase, N-terminal domain 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302875898|ref|YP_003844531.1|
Sequence length 670
Comment Ig domain-containing protein [Clostridium cellulovorans 743B]
Sequence
MIKNFLKKTLITTSLLLTFQLSITTPTNTTVNAATGSNYTWNNTIPAKYPSATNDNGKLV
LFDNSHGETAGQADWVLDGGFSDFADDLVNHGYTVKEYRGIDKNGDGCIRYYDDRQTSNV
DSNEAVITYDAIKDADVFIMAEANRPLTISERSALKQFVDSGKGLYLISDHYNADRNMNT
WDSTEVYNGYNRSNSTIYNMGLTYGDMRNPQDATKGWLAENFGLRFRFNAINLTAGFSGI
RSTTDSEGITAGVKPILMAAGSTLAIVDGSKAKGLVYLSSTDKPSKWGSAADTGLYFGGE
KEGAFVAISKPSAGKAAFIGDSSPIEDATTKYKHEGTGNSKSTHAGYTSAGNAATLSINI
VDWLSTPESYVGFDGINHTKGIATDTPMATIEKTESQAEPWATPSYNPWNTDTFAYGAYN
APQGPISTSTGGSGTGTTTVSVTGVSLNKTSLSLTAGATQTLTATIAPTNATNKSISWTS
SNTSVATVSSGTITAISLGTAIITAKTTDGAKTATCEVTVSASSTGTGTVTLISEGFTTV
RGTSSAISSGIPTNWIFSSGLAVYTTTGNYGKSSPSIKMQGTNNRVTTPTFTLSTQGTLS
FWIKGNGTNSTSALLVEKYDGTSWSTVANITSLPITGTTKTYTIPQNTIQVRLTYTKSVG
NVALDDISIK
Download sequence
Identical sequences D9STN3
gi|302875898|ref|YP_003844531.1| WP_010075863.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]