SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302875932|ref|YP_003844565.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302875932|ref|YP_003844565.1|
Domain Number 1 Region: 47-383
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.11e-68
Family beta-glycanases 0.00000359
Further Details:      
 
Domain Number 2 Region: 396-463
Classification Level Classification E-value
Superfamily Type I dockerin domain 4.71e-20
Family Type I dockerin domain 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302875932|ref|YP_003844565.1|
Sequence length 464
Comment glycoside hydrolase family protein [Clostridium cellulovorans 743B]
Sequence
MNKRSRIAAFITASIMTLGLAMTANSQITKAITSNPSAEKTIVRDNMTTTQLVADMGLGW
NLGNTLESCGSWITGNSVSSYETAWGAPITTKAMIDGVHNAGFNSIRIPVAWSNLMAADY
TISPALLSRVEEVANYALDNNMYVIINLHWDSGWLAGFSTNYDECMKKYKSIWTQLSERF
ANYGDHLIFESLNEEACFNDIWNRWGGTTGKDKAYGIANNINQAFVDLIRSSKGNNPKRH
LLIAGYATDIPLTCDPLYKMPTDPANRCAVSVHYYTPSTFTILEQDADWGKARTTWGTAE
DVAELQNYMNMMKVNFIDKGVPVIVGEYGTNNKNKTTDMVRLYLTSVAKEAYKLGMCPML
WDAGNMVMYDRNACQFKDPQFITEMKTIRDTARPTTQIIYGDLNNDKKVNAIDFALMKKY
ILDNSTPIDLKIADLNGDGKVNALDYAVFKKFLLGQITKFPVQS
Download sequence
Identical sequences A0A173N017 D9STR7
WP_010075900.1.47838 gi|302875932|ref|YP_003844565.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]