SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302875935|ref|YP_003844568.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302875935|ref|YP_003844568.1|
Domain Number 1 Region: 31-346
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.37e-67
Family Pectin methylesterase 0.0000417
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302875935|ref|YP_003844568.1|
Sequence length 350
Comment pectinesterase [Clostridium cellulovorans 743B]
Sequence
MKKNILRKALVFVVTSAIVGAVVMSNQVALAATSYDVTVAKDGSGNYKTITEAYNYLAKI
NDNKRKTIHVKPGVYKEQLTISKAYVSIVGENKNNTKLTYNVANGDAKPSGGKYGSADCA
ALIVATNDFVAQNISFENSHLKDTGNDVQASCVYTYGDRATFNNCNFYSGQDTLCAYTYG
VDKSRVYFKDCFIQGSVDFIWGGAIAFFENCTLNQLRDGGMYTAANTPQGQKYGYVFSNC
TLTANGDANYTAKTNPSWKKPSTVYLGRTYGDYCHVSYINCKLNAPVNPVGWLKMSNRNV
NNTALLEESGCTGTGANRSKRVTWSKALTSSEAAKYTKVNVLSGKDGWRP
Download sequence
Identical sequences A0A173N011 D9STS0
WP_010073100.1.47838 gi|302875935|ref|YP_003844568.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]