SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302875993|ref|YP_003844626.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302875993|ref|YP_003844626.1|
Domain Number 1 Region: 379-459
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 3.45e-16
Family Invasin/intimin cell-adhesion fragments 0.0049
Further Details:      
 
Domain Number 2 Region: 549-627
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 6.28e-16
Family Invasin/intimin cell-adhesion fragments 0.0061
Further Details:      
 
Domain Number 3 Region: 466-544
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.0000000000000114
Family Invasin/intimin cell-adhesion fragments 0.0092
Further Details:      
 
Domain Number 4 Region: 118-201
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.0000000000000549
Family Invasin/intimin cell-adhesion fragments 0.0026
Further Details:      
 
Domain Number 5 Region: 293-374
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.0000000000000706
Family Invasin/intimin cell-adhesion fragments 0.011
Further Details:      
 
Domain Number 6 Region: 204-289
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.0000000141
Family Invasin/intimin cell-adhesion fragments 0.0071
Further Details:      
 
Domain Number 7 Region: 32-112
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.00000455
Family Invasin/intimin cell-adhesion fragments 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302875993|ref|YP_003844626.1|
Sequence length 944
Comment Ig domain-containing protein [Clostridium cellulovorans 743B]
Sequence
MRKFKRLFSGIVAFIMLFSVLQLSEFTKVYGVTAVNSITFVNQPSSILIGETVKITPTID
PINAETDNGLVWTAANAYATVDTQGNVTGIAEGIAAIRVTCGSVNKIFKITVKDPAKLVS
NVQLTETSVKACIAQGQVSLTAIVNPDTATDKSVTWSSNNPAVADVADQSGTIQLNSVGI
ATITVQSINNPNAQATCEIQVLPQVTGISLDKTSITLEKKDVAQTATIKATLEPADAIQD
VVYQSSDMAVVQIDPTTGKIYPTVRDGVATITVSSASNPSVFATCEVIVLPKITGIALDV
SDIKISRAKREIHLLTTNVTPVGANSKVTFTSSDENVTKVNEDGLIIPVSGGTAIVTATS
VSDPSIFATCNVTVTPEPTEVEINKSEVTLSRVKGETAQLTAKVLPSDTEQEVEYSSDDP
KVATVDANGFITAVSEGTATITIVSPYQRTKPSTCKVTVVGTPSMINLNKTEATLNRYKG
ETVQLAVDVIPAGSETDVTYSSSDANIATVDANGLVTPVSDGVAIITAKSKYDVRVVKTC
TITVIGDPDSVKLNKTSAVLDLSREKNVTLESTVPEGTNPAVTYSSSDPKVAQVDAKGVV
TGLSVGQATITVTTVEGNKTATCLVTVIDKEKMKPTITVDNEEDTYKPVKVTVTAPTDYP
GLDLIEYNIDGSGWKIYKEPVEVKANCKFVAKTFDKFGNYSNFAQYEIKNIDNSKLLVLK
GDVIDKNIFNKVQGVDITVEDTVNSAGVTLKWSFNGKDVKDTSKELDLKLNDVSKNKDVI
ESKYVNPLIISFVNHGELPAPMTIRILVDPVKFDVNKALNLYYYNEDIAEADKKIQEIQK
GLIPEKDADGNYYVTVVLTHHSDYFLSIGEIVNTNPVIAPPVDPNGKPGVQVQVGDQVRA
GGQAQVSQNGTLVQTGSPIDMKALLSLGFLSLAAGAIFIAKKRR
Download sequence
Identical sequences D9SUA7
gi|302875993|ref|YP_003844626.1| WP_010073246.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]