SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302875998|ref|YP_003844631.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302875998|ref|YP_003844631.1|
Domain Number 1 Region: 584-696
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000000394
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.023
Further Details:      
 
Weak hits

Sequence:  gi|302875998|ref|YP_003844631.1|
Domain Number - Region: 401-452
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00362
Family Xylanase/endoglucanase 11/12 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302875998|ref|YP_003844631.1|
Sequence length 704
Comment M6 family metalloprotease domain-containing protein [Clostridium cellulovorans 743B]
Sequence
MKRVKEILMGAVLTAAVCCVFTTGVNGAPCKDKLFEAKQPDGTKVQVKVTGDEYYQQVES
LDGYTLCTDKDGWICYAKLNEDQSELISTGEVYKGKSSTKAMNFAAKAGANSNSNKHLKI
SKKAKEEKKNAVKKSLKVDDSTSKVASNVKNSFMYANGVTGTEASNGLLESKVSNSFLAA
NTLVSQENVKGLTILIDFPDVKSSISKEEINNFFNLQGYTGFGNNGSIRDYFYDVSGGKL
LYTNSVIGFYTAKHPKAYYDDVNASAGDYSKAVELATEAANWARTAGVDFSTLTKDQYGY
VKAVNLLYAGNADSPWGKGIWPHQGQIGNTGGITRYEMSNIGSDLAIDTICHENGHLICS
YPDLYDYDGDSQGTGGYSLMSGTSNPKNPAPPDPYCRNIISGWNITTDLNTYNNGSLITA
LSNGNANQEIYKWSGNDFQEYYLVENIKKVGRYADVPDEGLAVWHVDQRGDNSYNDMRAD
RHYLVSLVQADGRFDMEYNRNGGHDGDLFHGGYNTAINDNSMPNCKWWNGTASGLDISQI
SNLGSTMTFVKSGTTSTPTIDNLAKYATPSTSYCSPWEDIKALNDGIEPTNSNDRSAAVY
GNWVENAASKRVVWVQYDFSKSYKLSSCDLYWFKDNQGIDVPSSYKIKYWNGTSWVSVTN
AKGLGIEINKYNTTTFDPITTNKIRIEITANGTYSTGILEWKVK
Download sequence
Identical sequences D9SUB2
gi|302875998|ref|YP_003844631.1| WP_010073251.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]